Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BZF6

Protein Details
Accession A0A2V1BZF6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-44TSNTNNKSPIKKRPPTKPTPRRTAAAHydrophilic
NLS Segment(s)
PositionSequence
26-48SPIKKRPPTKPTPRRTAAARPRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAPRSSKPTTSTPSTKPNTSNTNNKSPIKKRPPTKPTPRRTAAARPRRQVQPSLSTAGSVSPTATQDILPQVQQQHLPSTVTQTHTTAQTTFPAGQSSHEMSIPMNMPSALETPTPGLYIFFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.56
4 0.56
5 0.57
6 0.57
7 0.62
8 0.58
9 0.63
10 0.65
11 0.67
12 0.7
13 0.68
14 0.72
15 0.72
16 0.75
17 0.73
18 0.77
19 0.8
20 0.82
21 0.86
22 0.86
23 0.84
24 0.85
25 0.81
26 0.74
27 0.7
28 0.7
29 0.69
30 0.7
31 0.68
32 0.63
33 0.65
34 0.68
35 0.65
36 0.59
37 0.53
38 0.49
39 0.43
40 0.42
41 0.35
42 0.29
43 0.26
44 0.21
45 0.18
46 0.11
47 0.09
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.09
57 0.1
58 0.11
59 0.12
60 0.14
61 0.14
62 0.14
63 0.14
64 0.15
65 0.14
66 0.17
67 0.19
68 0.2
69 0.2
70 0.2
71 0.2
72 0.21
73 0.22
74 0.18
75 0.16
76 0.15
77 0.16
78 0.16
79 0.15
80 0.16
81 0.15
82 0.15
83 0.19
84 0.2
85 0.19
86 0.18
87 0.18
88 0.16
89 0.2
90 0.19
91 0.15
92 0.13
93 0.12
94 0.12
95 0.13
96 0.14
97 0.12
98 0.11
99 0.12
100 0.13
101 0.14
102 0.15
103 0.13