Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BZR0

Protein Details
Accession A0A2V1BZR0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKPCLKNRSQSAPKRQKAQAFHydrophilic
130-167AWWWRRWKAATDRKPKGPKKDPKPGKGKGKGKRAGRSABasic
NLS Segment(s)
PositionSequence
134-170RRWKAATDRKPKGPKKDPKPGKGKGKGKRAGRSAGKG
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKPCLKNRSQSAPKRQKAQAFYQQPAVATPGFVPNAITAFVMGARMTGQARELGALPVRQNIDCRAVFNTANILAGTAYKSQYEAGQVQATGRYELVECTRCRTAGPYTSCKRARRQDVVLVPWTAPRTAWWWRRWKAATDRKPKGPKKDPKPGKGKGKGKRAGRSAGKGAGNSAASASTVIAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.78
4 0.74
5 0.73
6 0.72
7 0.68
8 0.64
9 0.62
10 0.57
11 0.49
12 0.44
13 0.37
14 0.26
15 0.2
16 0.18
17 0.15
18 0.14
19 0.14
20 0.14
21 0.12
22 0.12
23 0.12
24 0.11
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.05
31 0.05
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.09
41 0.11
42 0.13
43 0.12
44 0.15
45 0.16
46 0.16
47 0.17
48 0.18
49 0.21
50 0.2
51 0.21
52 0.19
53 0.21
54 0.2
55 0.19
56 0.19
57 0.13
58 0.13
59 0.12
60 0.1
61 0.07
62 0.07
63 0.08
64 0.07
65 0.08
66 0.07
67 0.08
68 0.08
69 0.08
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.11
77 0.11
78 0.09
79 0.08
80 0.07
81 0.07
82 0.08
83 0.1
84 0.13
85 0.13
86 0.16
87 0.17
88 0.17
89 0.17
90 0.19
91 0.2
92 0.23
93 0.28
94 0.33
95 0.35
96 0.44
97 0.5
98 0.52
99 0.56
100 0.57
101 0.61
102 0.59
103 0.6
104 0.59
105 0.58
106 0.58
107 0.53
108 0.45
109 0.37
110 0.32
111 0.29
112 0.21
113 0.16
114 0.13
115 0.14
116 0.23
117 0.3
118 0.35
119 0.44
120 0.47
121 0.56
122 0.57
123 0.6
124 0.62
125 0.66
126 0.69
127 0.7
128 0.74
129 0.75
130 0.83
131 0.83
132 0.83
133 0.82
134 0.83
135 0.82
136 0.86
137 0.86
138 0.85
139 0.88
140 0.87
141 0.87
142 0.87
143 0.87
144 0.84
145 0.85
146 0.83
147 0.82
148 0.81
149 0.76
150 0.75
151 0.73
152 0.71
153 0.66
154 0.65
155 0.59
156 0.5
157 0.46
158 0.4
159 0.33
160 0.26
161 0.22
162 0.15
163 0.12
164 0.12
165 0.11