Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BE92

Protein Details
Accession A0A2V1BE92   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
161-180EDGAVRKKPKKRGGLDWTLEBasic
NLS Segment(s)
PositionSequence
166-172RKKPKKR
Subcellular Location(s) nucl 15.5, mito_nucl 10.5, cyto 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022816  Condensin_barren_su2  
Gene Ontology GO:0000796  C:condensin complex  
GO:0005737  C:cytoplasm  
GO:0051301  P:cell division  
GO:0007076  P:mitotic chromosome condensation  
Pfam View protein in Pfam  
PF05786  Cnd2  
Amino Acid Sequences MNQIKAAASPMRKLTNFEPASSSPSSNPKTPRRTLGKENDLDGGAIVIGGTAVTPLERVPILANFEEWMKMATDNKINVANSWNFALIDYFYDMSLLKEGDGVNFQKASCTLDGCVKIYTSRVDSVAAKTGKPLSGLAGSGNSKKNGESEEGEESEEVEDEDGAVRKKPKKRGGLDWTLELG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.42
4 0.39
5 0.39
6 0.33
7 0.38
8 0.36
9 0.34
10 0.27
11 0.35
12 0.37
13 0.38
14 0.45
15 0.49
16 0.55
17 0.58
18 0.64
19 0.64
20 0.68
21 0.71
22 0.73
23 0.73
24 0.67
25 0.64
26 0.57
27 0.48
28 0.41
29 0.31
30 0.21
31 0.11
32 0.08
33 0.06
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.06
47 0.08
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.1
55 0.09
56 0.07
57 0.07
58 0.09
59 0.11
60 0.14
61 0.14
62 0.15
63 0.18
64 0.17
65 0.17
66 0.19
67 0.17
68 0.14
69 0.15
70 0.13
71 0.1
72 0.1
73 0.1
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.09
89 0.09
90 0.1
91 0.1
92 0.1
93 0.09
94 0.1
95 0.12
96 0.1
97 0.1
98 0.1
99 0.14
100 0.15
101 0.16
102 0.16
103 0.14
104 0.14
105 0.14
106 0.16
107 0.13
108 0.13
109 0.13
110 0.14
111 0.16
112 0.17
113 0.23
114 0.22
115 0.2
116 0.2
117 0.22
118 0.21
119 0.2
120 0.19
121 0.13
122 0.14
123 0.14
124 0.13
125 0.15
126 0.16
127 0.19
128 0.22
129 0.22
130 0.21
131 0.21
132 0.23
133 0.21
134 0.23
135 0.22
136 0.22
137 0.26
138 0.26
139 0.26
140 0.24
141 0.22
142 0.19
143 0.16
144 0.12
145 0.07
146 0.06
147 0.06
148 0.08
149 0.1
150 0.11
151 0.15
152 0.22
153 0.3
154 0.38
155 0.48
156 0.56
157 0.63
158 0.7
159 0.77
160 0.79
161 0.82
162 0.78