Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BDU2

Protein Details
Accession A0A2V1BDU2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-59SSVRRDRRSRHNSRRGSHSTBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPSFFDNVHNSITTCETAGPTVHQLERMQLVESNTPREESSVRRDRRSRHNSRRGSHSTYVDTSGKAYRVREPSRVYHKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.13
5 0.13
6 0.13
7 0.13
8 0.15
9 0.15
10 0.17
11 0.16
12 0.17
13 0.19
14 0.18
15 0.17
16 0.16
17 0.17
18 0.2
19 0.2
20 0.22
21 0.2
22 0.2
23 0.19
24 0.18
25 0.18
26 0.16
27 0.24
28 0.3
29 0.33
30 0.38
31 0.43
32 0.47
33 0.57
34 0.64
35 0.66
36 0.68
37 0.75
38 0.78
39 0.78
40 0.81
41 0.77
42 0.74
43 0.68
44 0.61
45 0.55
46 0.48
47 0.48
48 0.4
49 0.34
50 0.28
51 0.26
52 0.25
53 0.24
54 0.24
55 0.27
56 0.36
57 0.4
58 0.45
59 0.48
60 0.53
61 0.61