Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B653

Protein Details
Accession A0A2V1B653   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MDNVNVKRNEERKKRKKKNEGINRRKKTLIKBasic
NLS Segment(s)
PositionSequence
8-32RNEERKKRKKKNEGINRRKKTLIKK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MDNVNVKRNEERKKRKKKNEGINRRKKTLIKKAYELGKLDGIDVALIISKYGRYTTYSSNGYASRFPSMAEIQAAYPLPKNLLPKDVERRLSNKRKEITEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.95
4 0.94
5 0.95
6 0.94
7 0.95
8 0.95
9 0.95
10 0.91
11 0.84
12 0.8
13 0.75
14 0.74
15 0.74
16 0.72
17 0.67
18 0.64
19 0.65
20 0.66
21 0.63
22 0.54
23 0.45
24 0.38
25 0.33
26 0.28
27 0.22
28 0.15
29 0.11
30 0.09
31 0.06
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.05
40 0.08
41 0.1
42 0.14
43 0.19
44 0.2
45 0.21
46 0.22
47 0.23
48 0.22
49 0.21
50 0.19
51 0.16
52 0.15
53 0.14
54 0.15
55 0.15
56 0.14
57 0.13
58 0.13
59 0.11
60 0.13
61 0.13
62 0.11
63 0.12
64 0.11
65 0.12
66 0.14
67 0.19
68 0.18
69 0.24
70 0.26
71 0.32
72 0.41
73 0.47
74 0.5
75 0.5
76 0.55
77 0.6
78 0.68
79 0.69
80 0.69
81 0.67
82 0.67