Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BRL8

Protein Details
Accession A0A2V1BRL8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-35FKAYTPKSEKDKTPKPKKDNTRKPISKSITHydrophilic
NLS Segment(s)
PositionSequence
15-29KDKTPKPKKDNTRKP
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
Amino Acid Sequences MADLIFKAYTPKSEKDKTPKPKKDNTRKPISKSITEKPSLPDKSLQINSYDVPFEVSPVEAAGINHWCQTIVGDNETRVQDIQVLGSELARTRGMYSDCPCLSRHLYLLLCSNFESREGWLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.67
4 0.72
5 0.78
6 0.82
7 0.82
8 0.86
9 0.89
10 0.9
11 0.91
12 0.89
13 0.89
14 0.86
15 0.85
16 0.85
17 0.79
18 0.76
19 0.71
20 0.7
21 0.66
22 0.6
23 0.55
24 0.48
25 0.52
26 0.45
27 0.41
28 0.36
29 0.31
30 0.36
31 0.37
32 0.34
33 0.27
34 0.26
35 0.25
36 0.22
37 0.2
38 0.12
39 0.12
40 0.11
41 0.1
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.1
58 0.09
59 0.11
60 0.12
61 0.12
62 0.15
63 0.16
64 0.16
65 0.12
66 0.11
67 0.1
68 0.1
69 0.1
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.07
76 0.09
77 0.09
78 0.09
79 0.09
80 0.13
81 0.15
82 0.19
83 0.22
84 0.28
85 0.29
86 0.3
87 0.3
88 0.31
89 0.33
90 0.3
91 0.28
92 0.26
93 0.27
94 0.27
95 0.34
96 0.3
97 0.28
98 0.27
99 0.27
100 0.22
101 0.22
102 0.21