Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BPX2

Protein Details
Accession A0A2V1BPX2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MTSVSRKKNGCTSCRRRHLKCDNIEPSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 14, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTSVSRKKNGCTSCRRRHLKCDNIEPSCANCVAANLECARVVNVRFRHVTDVGPLDPEQKWVKTASRNRWYLPFHRGTFTYSTKAYLSTSPRFCGQFTVRKMDQLRVWNSQIRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.82
4 0.84
5 0.86
6 0.84
7 0.82
8 0.82
9 0.8
10 0.73
11 0.7
12 0.61
13 0.52
14 0.45
15 0.37
16 0.26
17 0.17
18 0.15
19 0.15
20 0.14
21 0.13
22 0.11
23 0.12
24 0.11
25 0.11
26 0.12
27 0.11
28 0.11
29 0.17
30 0.18
31 0.21
32 0.22
33 0.23
34 0.26
35 0.25
36 0.24
37 0.19
38 0.2
39 0.17
40 0.17
41 0.16
42 0.14
43 0.13
44 0.16
45 0.15
46 0.13
47 0.14
48 0.14
49 0.17
50 0.24
51 0.32
52 0.39
53 0.46
54 0.48
55 0.49
56 0.54
57 0.55
58 0.5
59 0.5
60 0.47
61 0.4
62 0.4
63 0.39
64 0.36
65 0.37
66 0.35
67 0.31
68 0.24
69 0.25
70 0.23
71 0.23
72 0.21
73 0.21
74 0.25
75 0.29
76 0.31
77 0.32
78 0.35
79 0.35
80 0.34
81 0.36
82 0.36
83 0.37
84 0.39
85 0.45
86 0.42
87 0.48
88 0.5
89 0.49
90 0.48
91 0.48
92 0.5
93 0.47
94 0.51
95 0.5