Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BSV0

Protein Details
Accession A0A2V1BSV0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
12-38LSESELPTHRQRRRKRGDGSKKSGIREBasic
NLS Segment(s)
PositionSequence
21-34RQRRRKRGDGSKKS
Subcellular Location(s) nucl 18, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR034904  FSCA_dom_sf  
IPR039796  MIP18  
IPR002744  MIP18-like  
Gene Ontology GO:0106035  P:protein maturation by [4Fe-4S] cluster transfer  
Pfam View protein in Pfam  
PF01883  FeS_assembly_P  
Amino Acid Sequences MAALDNANPTILSESELPTHRQRRRKRGDGSKKSGIRELLMAKPSYALDPFYMSDFSDTDSDDSSVEPIDEQEIYDLIAPISDPEHPLSLESLGVVKLQDVHLISPPDLTNPAALSRVLVKLTPTVTHCSLATVIGLGVRVRLEQALPPSYRVEVKIKEGTHSQADEVNKQLADKERVAAALENDNLMGILKKMMKPCMET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.21
4 0.25
5 0.31
6 0.41
7 0.47
8 0.55
9 0.63
10 0.7
11 0.79
12 0.84
13 0.85
14 0.87
15 0.91
16 0.92
17 0.9
18 0.89
19 0.84
20 0.76
21 0.71
22 0.61
23 0.5
24 0.44
25 0.4
26 0.35
27 0.34
28 0.31
29 0.26
30 0.26
31 0.25
32 0.22
33 0.18
34 0.14
35 0.11
36 0.13
37 0.13
38 0.13
39 0.13
40 0.12
41 0.12
42 0.11
43 0.12
44 0.11
45 0.11
46 0.1
47 0.11
48 0.11
49 0.1
50 0.1
51 0.08
52 0.08
53 0.07
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.05
83 0.04
84 0.05
85 0.05
86 0.07
87 0.06
88 0.07
89 0.09
90 0.1
91 0.1
92 0.11
93 0.11
94 0.1
95 0.1
96 0.1
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.11
110 0.13
111 0.13
112 0.16
113 0.17
114 0.18
115 0.17
116 0.17
117 0.16
118 0.14
119 0.12
120 0.08
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.08
132 0.13
133 0.17
134 0.18
135 0.2
136 0.21
137 0.22
138 0.23
139 0.24
140 0.26
141 0.23
142 0.28
143 0.33
144 0.32
145 0.34
146 0.35
147 0.35
148 0.33
149 0.32
150 0.27
151 0.25
152 0.27
153 0.26
154 0.26
155 0.26
156 0.22
157 0.21
158 0.24
159 0.26
160 0.29
161 0.27
162 0.27
163 0.25
164 0.25
165 0.27
166 0.25
167 0.2
168 0.21
169 0.2
170 0.18
171 0.17
172 0.16
173 0.14
174 0.13
175 0.11
176 0.06
177 0.11
178 0.15
179 0.19
180 0.23
181 0.29