Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BNI7

Protein Details
Accession A0A2V1BNI7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-70IHIVTNKPYKKPKPVKGAAKHydrophilic
NLS Segment(s)
PositionSequence
60-70KKPKPVKGAAK
Subcellular Location(s) mito 8, E.R. 6, cyto 5, plas 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQAFSGPNAFKFFGFTPEATAVLQRTPMLLVILVLVLFSMIGLGLLAFYIHIVTNKPYKKPKPVKGAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.21
4 0.21
5 0.21
6 0.22
7 0.18
8 0.18
9 0.15
10 0.12
11 0.13
12 0.09
13 0.08
14 0.07
15 0.08
16 0.07
17 0.06
18 0.05
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.01
29 0.01
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.04
39 0.05
40 0.06
41 0.1
42 0.18
43 0.23
44 0.3
45 0.4
46 0.47
47 0.58
48 0.67
49 0.74
50 0.76