Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CEF8

Protein Details
Accession A0A2V1CEF8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-88SEDYRKSKDGWKPKAKKREMKLBasic
NLS Segment(s)
PositionSequence
72-85KSKDGWKPKAKKRE
Subcellular Location(s) cyto_nucl 10.833, cyto 10.5, nucl 10, mito_nucl 7.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR039949  NAA40  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043998  F:histone H2A acetyltransferase activity  
GO:0010485  F:histone H4 acetyltransferase activity  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MAEVDQIEVANKKSLEGFVETYFPGTDWKSWIHPKTSTPYSLSLQTASALPPSDFTACFNLIETTSSEDYRKSKDGWKPKAKKREMKLLDLKYLLVKKEGKVEGFVSFMPTYEDGYPVVYCYEIHLGEELRGTGLGKTLMQHLVTIGKAIPSTEKVMLTVFTRNERAVAFYTNLGYTKDEYSPPPRVLRNGTVMEAEYVILSRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.23
5 0.19
6 0.22
7 0.21
8 0.2
9 0.19
10 0.17
11 0.16
12 0.14
13 0.14
14 0.15
15 0.17
16 0.23
17 0.31
18 0.35
19 0.37
20 0.38
21 0.41
22 0.47
23 0.49
24 0.46
25 0.4
26 0.4
27 0.38
28 0.39
29 0.35
30 0.28
31 0.23
32 0.21
33 0.19
34 0.15
35 0.14
36 0.11
37 0.1
38 0.1
39 0.12
40 0.13
41 0.12
42 0.13
43 0.16
44 0.15
45 0.15
46 0.15
47 0.14
48 0.13
49 0.13
50 0.12
51 0.13
52 0.14
53 0.15
54 0.14
55 0.16
56 0.18
57 0.21
58 0.23
59 0.21
60 0.27
61 0.34
62 0.44
63 0.52
64 0.61
65 0.67
66 0.73
67 0.82
68 0.83
69 0.83
70 0.78
71 0.78
72 0.71
73 0.7
74 0.7
75 0.63
76 0.57
77 0.49
78 0.44
79 0.37
80 0.35
81 0.26
82 0.21
83 0.19
84 0.17
85 0.24
86 0.25
87 0.21
88 0.21
89 0.21
90 0.18
91 0.18
92 0.17
93 0.13
94 0.11
95 0.11
96 0.1
97 0.1
98 0.11
99 0.1
100 0.11
101 0.08
102 0.09
103 0.09
104 0.08
105 0.08
106 0.06
107 0.06
108 0.07
109 0.09
110 0.08
111 0.08
112 0.09
113 0.09
114 0.09
115 0.1
116 0.08
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.06
123 0.06
124 0.07
125 0.09
126 0.11
127 0.11
128 0.1
129 0.1
130 0.11
131 0.11
132 0.11
133 0.09
134 0.08
135 0.08
136 0.08
137 0.1
138 0.1
139 0.13
140 0.15
141 0.15
142 0.14
143 0.15
144 0.16
145 0.16
146 0.18
147 0.17
148 0.19
149 0.21
150 0.21
151 0.22
152 0.21
153 0.22
154 0.19
155 0.2
156 0.18
157 0.17
158 0.18
159 0.18
160 0.19
161 0.17
162 0.17
163 0.16
164 0.17
165 0.19
166 0.19
167 0.23
168 0.29
169 0.34
170 0.37
171 0.41
172 0.41
173 0.44
174 0.48
175 0.49
176 0.49
177 0.46
178 0.43
179 0.38
180 0.36
181 0.32
182 0.26
183 0.2
184 0.13
185 0.11