Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CFM9

Protein Details
Accession A0A2V1CFM9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-88ERANKWKRPALHVPRHKPTKRAPBasic
NLS Segment(s)
PositionSequence
69-89NKWKRPALHVPRHKPTKRAPS
Subcellular Location(s) extr 21, mito 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGWDRESYLPSSFILAWAGVLALGAIIYNLNSYSSNMQARQNAEAKGENIRFRTQAAYDGLAGEGERANKWKRPALHVPRHKPTKRAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.09
5 0.08
6 0.05
7 0.05
8 0.04
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.05
19 0.06
20 0.08
21 0.11
22 0.13
23 0.15
24 0.17
25 0.2
26 0.21
27 0.23
28 0.25
29 0.22
30 0.22
31 0.21
32 0.19
33 0.22
34 0.23
35 0.21
36 0.21
37 0.21
38 0.2
39 0.2
40 0.21
41 0.16
42 0.18
43 0.17
44 0.16
45 0.15
46 0.15
47 0.14
48 0.12
49 0.11
50 0.08
51 0.08
52 0.07
53 0.08
54 0.13
55 0.16
56 0.21
57 0.25
58 0.31
59 0.34
60 0.41
61 0.51
62 0.57
63 0.65
64 0.71
65 0.77
66 0.81
67 0.88
68 0.84
69 0.8