Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B9M0

Protein Details
Accession A0A2V1B9M0   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-89AEGPVFGKKKKKPTGRHSNKPYSECSHydrophilic
NLS Segment(s)
PositionSequence
46-80RRPRTSPSPSLKSGSSRGAEGPVFGKKKKKPTGRH
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTQIAERRSESDAVRRHPRPSSHSPHRCHGCHDRRGSYPHLRIALRRPRTSPSPSLKSGSSRGAEGPVFGKKKKKPTGRHSNKPYSECSRSYFFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.51
4 0.55
5 0.58
6 0.57
7 0.6
8 0.62
9 0.64
10 0.7
11 0.7
12 0.73
13 0.75
14 0.68
15 0.65
16 0.66
17 0.64
18 0.63
19 0.64
20 0.59
21 0.55
22 0.58
23 0.58
24 0.56
25 0.5
26 0.46
27 0.44
28 0.4
29 0.39
30 0.44
31 0.47
32 0.44
33 0.43
34 0.41
35 0.4
36 0.44
37 0.47
38 0.46
39 0.44
40 0.43
41 0.44
42 0.44
43 0.42
44 0.4
45 0.38
46 0.35
47 0.27
48 0.23
49 0.21
50 0.22
51 0.2
52 0.18
53 0.17
54 0.19
55 0.22
56 0.24
57 0.32
58 0.35
59 0.46
60 0.55
61 0.62
62 0.66
63 0.73
64 0.82
65 0.85
66 0.9
67 0.9
68 0.91
69 0.88
70 0.82
71 0.78
72 0.75
73 0.7
74 0.62
75 0.57
76 0.51