Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CWI1

Protein Details
Accession A0A2V1CWI1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
39-62EGDKKCRYCQHERCKKCGKDPKKPBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGSKNSLLRLFFDHPWVCCRSAQDPTHARNEHGWFKQLEGDKKCRYCQHERCKKCGKDPKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.35
4 0.3
5 0.27
6 0.3
7 0.26
8 0.32
9 0.32
10 0.36
11 0.39
12 0.4
13 0.48
14 0.45
15 0.42
16 0.39
17 0.42
18 0.4
19 0.34
20 0.34
21 0.25
22 0.26
23 0.3
24 0.3
25 0.33
26 0.32
27 0.39
28 0.43
29 0.47
30 0.51
31 0.52
32 0.55
33 0.58
34 0.63
35 0.67
36 0.71
37 0.73
38 0.78
39 0.82
40 0.81
41 0.81
42 0.81