Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8P1Q4

Protein Details
Accession A8P1Q4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
216-236DEDVKPEKKKIKKEKVDEDVDAcidic
263-286EDEESGKKRKKKANGSAKPAKKAKBasic
NLS Segment(s)
PositionSequence
223-228KKKIKK
268-296GKKRKKKANGSAKPAKKAKTGSSSKGKKK
Subcellular Location(s) cyto_nucl 13.833, cyto 13.5, nucl 13, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022649  Pr_cel_nuc_antig_C  
IPR022659  Pr_cel_nuc_antig_CS  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006260  P:DNA replication  
GO:0006275  P:regulation of DNA replication  
KEGG cci:CC1G_05633  -  
Pfam View protein in Pfam  
PF02747  PCNA_C  
PF00705  PCNA_N  
PROSITE View protein in PROSITE  
PS01251  PCNA_1  
PS00293  PCNA_2  
CDD cd00577  PCNA  
Amino Acid Sequences MLEAKLAEAGLLKKLLDAIKELVTDANFECNEEGINLQAMDNSHVALVAVKILVSGFKRYRCDRPMPLGVNLGSLTKVLKCAKDDDICTLKAADEADVLNLIYEAKNSDRIAEYEMKLMEIDADALTIPDTEYEARVTMPSSEFARIVRDLSQLGESVRIEVSKEGVRFAAEGESANGNVLLRQTEGAITGGRIVAKTEEDEDGDGEKGEDGDEEDEDVKPEKKKIKKEKVDEDVDMNEDEEEEFKPDVDEDGEEEQDEDEDEDEESGKKRKKKANGSAKPAKKAKTGSSSKGKKKSDDDDDVDGILIEMNQHVSLTFSLKYLVNFAKSTSLSAKVQLMMSNDVPLLVSYDFGQGYIRYYLAPKIGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.19
5 0.2
6 0.21
7 0.22
8 0.22
9 0.21
10 0.19
11 0.2
12 0.17
13 0.21
14 0.18
15 0.18
16 0.18
17 0.16
18 0.16
19 0.15
20 0.14
21 0.09
22 0.11
23 0.1
24 0.09
25 0.11
26 0.11
27 0.13
28 0.13
29 0.12
30 0.1
31 0.1
32 0.1
33 0.09
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.09
41 0.1
42 0.17
43 0.21
44 0.27
45 0.33
46 0.38
47 0.48
48 0.51
49 0.58
50 0.58
51 0.62
52 0.66
53 0.63
54 0.61
55 0.56
56 0.49
57 0.42
58 0.35
59 0.27
60 0.18
61 0.15
62 0.13
63 0.09
64 0.15
65 0.16
66 0.19
67 0.2
68 0.24
69 0.3
70 0.34
71 0.34
72 0.36
73 0.37
74 0.35
75 0.33
76 0.3
77 0.24
78 0.2
79 0.19
80 0.13
81 0.1
82 0.09
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.07
92 0.07
93 0.12
94 0.12
95 0.14
96 0.15
97 0.16
98 0.2
99 0.24
100 0.23
101 0.22
102 0.22
103 0.2
104 0.19
105 0.18
106 0.14
107 0.08
108 0.08
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.11
129 0.12
130 0.12
131 0.12
132 0.14
133 0.13
134 0.14
135 0.14
136 0.13
137 0.12
138 0.13
139 0.13
140 0.11
141 0.11
142 0.12
143 0.1
144 0.1
145 0.1
146 0.09
147 0.08
148 0.08
149 0.1
150 0.11
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.11
157 0.09
158 0.06
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.06
165 0.05
166 0.05
167 0.06
168 0.05
169 0.04
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.06
184 0.06
185 0.07
186 0.07
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.08
193 0.06
194 0.06
195 0.05
196 0.05
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.06
203 0.06
204 0.07
205 0.09
206 0.11
207 0.12
208 0.17
209 0.25
210 0.31
211 0.41
212 0.52
213 0.61
214 0.68
215 0.75
216 0.8
217 0.8
218 0.78
219 0.69
220 0.6
221 0.5
222 0.42
223 0.33
224 0.24
225 0.15
226 0.11
227 0.09
228 0.08
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.09
236 0.08
237 0.08
238 0.08
239 0.1
240 0.1
241 0.1
242 0.1
243 0.09
244 0.09
245 0.09
246 0.07
247 0.05
248 0.05
249 0.06
250 0.06
251 0.06
252 0.07
253 0.09
254 0.16
255 0.22
256 0.28
257 0.36
258 0.44
259 0.53
260 0.63
261 0.72
262 0.76
263 0.8
264 0.84
265 0.86
266 0.85
267 0.84
268 0.79
269 0.71
270 0.66
271 0.61
272 0.58
273 0.58
274 0.58
275 0.58
276 0.63
277 0.69
278 0.73
279 0.78
280 0.75
281 0.71
282 0.71
283 0.72
284 0.7
285 0.69
286 0.64
287 0.59
288 0.56
289 0.5
290 0.42
291 0.33
292 0.24
293 0.15
294 0.11
295 0.06
296 0.05
297 0.06
298 0.06
299 0.06
300 0.06
301 0.07
302 0.08
303 0.1
304 0.11
305 0.1
306 0.13
307 0.14
308 0.15
309 0.19
310 0.21
311 0.22
312 0.22
313 0.23
314 0.26
315 0.25
316 0.28
317 0.26
318 0.28
319 0.25
320 0.28
321 0.29
322 0.25
323 0.26
324 0.26
325 0.25
326 0.25
327 0.25
328 0.24
329 0.21
330 0.18
331 0.17
332 0.15
333 0.14
334 0.1
335 0.1
336 0.09
337 0.12
338 0.12
339 0.12
340 0.14
341 0.11
342 0.15
343 0.16
344 0.15
345 0.13
346 0.15
347 0.19
348 0.21