Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B6U3

Protein Details
Accession A0A2V1B6U3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-52KGSTRTLKAKPRTRRIFNSRVDRHydrophilic
NLS Segment(s)
PositionSequence
31-60GSTRTLKAKPRTRRIFNSRVDRLKKKKELY
63-63K
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MSDTRSLNHRPRTILSPPAIIQVNASRGIKGSTRTLKAKPRTRRIFNSRVDRLKKKKELYLQKRAKQRQQLEEQSGENLELLQELDVKECMLEIKSVILEKLAADENHLKGLVEVPGKVVNFDKRVKEVAEALTMLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.44
4 0.4
5 0.41
6 0.38
7 0.31
8 0.28
9 0.24
10 0.24
11 0.24
12 0.23
13 0.19
14 0.18
15 0.2
16 0.2
17 0.19
18 0.25
19 0.28
20 0.33
21 0.37
22 0.43
23 0.5
24 0.58
25 0.65
26 0.67
27 0.71
28 0.75
29 0.79
30 0.82
31 0.82
32 0.81
33 0.8
34 0.8
35 0.77
36 0.76
37 0.76
38 0.75
39 0.75
40 0.75
41 0.75
42 0.69
43 0.67
44 0.67
45 0.71
46 0.71
47 0.74
48 0.73
49 0.71
50 0.77
51 0.77
52 0.74
53 0.72
54 0.69
55 0.66
56 0.65
57 0.65
58 0.59
59 0.54
60 0.48
61 0.39
62 0.33
63 0.25
64 0.17
65 0.11
66 0.07
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.05
79 0.06
80 0.05
81 0.06
82 0.07
83 0.08
84 0.07
85 0.07
86 0.07
87 0.06
88 0.09
89 0.11
90 0.1
91 0.13
92 0.17
93 0.18
94 0.19
95 0.19
96 0.17
97 0.14
98 0.16
99 0.17
100 0.14
101 0.13
102 0.14
103 0.17
104 0.17
105 0.19
106 0.21
107 0.23
108 0.27
109 0.32
110 0.34
111 0.34
112 0.38
113 0.38
114 0.36
115 0.34
116 0.32
117 0.3
118 0.26