Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BE64

Protein Details
Accession A0A2V1BE64   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-72HKRNKPPAPTPHPKHHQKIKSRKPKHSQATQSBasic
NLS Segment(s)
PositionSequence
42-66KRNKPPAPTPHPKHHQKIKSRKPKH
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MRELEVAGDIPPCGAAAGKRRVSSLRTAEFMTSSASTSFVHKRNKPPAPTPHPKHHQKIKSRKPKHSQATQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.16
4 0.24
5 0.28
6 0.29
7 0.31
8 0.33
9 0.35
10 0.39
11 0.38
12 0.32
13 0.3
14 0.31
15 0.29
16 0.27
17 0.25
18 0.2
19 0.13
20 0.11
21 0.09
22 0.09
23 0.09
24 0.12
25 0.16
26 0.21
27 0.28
28 0.33
29 0.41
30 0.5
31 0.57
32 0.59
33 0.62
34 0.66
35 0.68
36 0.74
37 0.73
38 0.73
39 0.76
40 0.79
41 0.8
42 0.8
43 0.8
44 0.8
45 0.84
46 0.85
47 0.87
48 0.88
49 0.9
50 0.89
51 0.91
52 0.9