Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D6RMV2

Protein Details
Accession D6RMV2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQTRKAHRNGIKRPKSHHydrophilic
NLS Segment(s)
PositionSequence
14-54RKAHRNGIKRPKSHRTPSMKGVDPKFRRNARFARVGSERAR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_14588  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQTRKAHRNGIKRPKSHRTPSMKGVDPKFRRNARFARVGSERARAEQKAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.74
5 0.75
6 0.77
7 0.82
8 0.8
9 0.77
10 0.78
11 0.78
12 0.79
13 0.77
14 0.76
15 0.73
16 0.69
17 0.7
18 0.68
19 0.63
20 0.6
21 0.57
22 0.58
23 0.53
24 0.55
25 0.56
26 0.56
27 0.54
28 0.56
29 0.58
30 0.54
31 0.58
32 0.53
33 0.51
34 0.49
35 0.51
36 0.47
37 0.47
38 0.43
39 0.38
40 0.43
41 0.37
42 0.35
43 0.33