Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1CT81

Protein Details
Accession A0A2V1CT81    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-62NRPTHPRNPPSPQRRRRRRSKVLRHSRNFTPBasic
NLS Segment(s)
PositionSequence
37-75PRNPPSPQRRRRRRSKVLRHSRNFTPPSLRQHPLRRRLR
Subcellular Location(s) extr 10, nucl 9, mito 3, plas 3
Family & Domain DBs
Amino Acid Sequences MKFTTASTILALASSTLAADGIFAITGTGQVNRPTHPRNPPSPQRRRRRRSKVLRHSRNFTPPSLRQHPLRRRLRPDIPVAQHPRGHRGDVHQPHEYVYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.04
14 0.05
15 0.06
16 0.08
17 0.12
18 0.13
19 0.15
20 0.21
21 0.24
22 0.3
23 0.38
24 0.42
25 0.46
26 0.53
27 0.61
28 0.67
29 0.74
30 0.77
31 0.79
32 0.85
33 0.86
34 0.89
35 0.89
36 0.9
37 0.9
38 0.91
39 0.92
40 0.92
41 0.94
42 0.88
43 0.83
44 0.77
45 0.75
46 0.66
47 0.57
48 0.53
49 0.48
50 0.51
51 0.52
52 0.5
53 0.47
54 0.56
55 0.62
56 0.65
57 0.7
58 0.7
59 0.72
60 0.78
61 0.79
62 0.74
63 0.73
64 0.71
65 0.66
66 0.67
67 0.66
68 0.62
69 0.59
70 0.55
71 0.55
72 0.48
73 0.46
74 0.39
75 0.38
76 0.44
77 0.49
78 0.53
79 0.5
80 0.47