Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BC92

Protein Details
Accession A0A2V1BC92    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-30KTTDTRNKLGKKPKEWKPLSKTATHydrophilic
NLS Segment(s)
PositionSequence
17-20KKPK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences KKSLLGKTTDTRNKLGKKPKEWKPLSKTATYKWLNRLGFHTTEEKKRVYVDGHERENIIKYRQKEFLPQMTYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.66
4 0.68
5 0.75
6 0.8
7 0.82
8 0.81
9 0.83
10 0.8
11 0.81
12 0.74
13 0.72
14 0.64
15 0.56
16 0.59
17 0.53
18 0.49
19 0.44
20 0.48
21 0.41
22 0.39
23 0.39
24 0.33
25 0.31
26 0.29
27 0.31
28 0.27
29 0.31
30 0.34
31 0.31
32 0.29
33 0.28
34 0.29
35 0.24
36 0.28
37 0.32
38 0.36
39 0.39
40 0.4
41 0.39
42 0.38
43 0.41
44 0.37
45 0.32
46 0.31
47 0.31
48 0.36
49 0.41
50 0.41
51 0.45
52 0.5
53 0.53