Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CAC2

Protein Details
Accession A0A2V1CAC2    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-46SKTSRVKFSNLPVRKRKRPPATEGPSEDHydrophilic
326-356IFTINQRRKEKVRRKRAEKRWEKRDEVRQTABasic
NLS Segment(s)
PositionSequence
32-36RKRKR
332-349RRKEKVRRKRAEKRWEKR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007224  TIF_Rrn11  
Gene Ontology GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
Pfam View protein in Pfam  
PF04090  RNA_pol_I_TF  
Amino Acid Sequences MPLFALPLAPSSITQHAESKTSRVKFSNLPVRKRKRPPATEGPSEDENSSLDGDAAPAATNPLSLTPREIAQYQLSGLELDQELPDVKGFPHRALPQSFGSRDKNGRGRGRKTAGDTDIDEEENKVQEEQEGDKAETISRGPFLRNQHLSVLTTILHRCLGEGDIQRASRAWAMLLRTQISGRGIDVRSNGYWEIGAALLMRSRDKKKKYSYDDEESDEEEETVEEDEEDPGVERRWGSREGLELAKSYYERLILEFPYNRQFQRSVSALDFWPAMVGCEIYGVQIEQKEGLRKVEKQEEKDDEDDGSGDESLSSDEIEEDPEQDIFTINQRRKEKVRRKRAEKRWEKRDEVRQTALAASDNIAAKLDEIMTTPPYSDNHNLLRLRGMLALYIGDLSVPAMPLEQDEDDNEASVRGSQRLGELDKNTERRFLYRQRVAEHERGQKIQQAEQERAAKLFERIIRDGGEDEDIRDFSLRMNKPEEEEVDDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.32
5 0.33
6 0.36
7 0.4
8 0.42
9 0.45
10 0.43
11 0.46
12 0.47
13 0.56
14 0.59
15 0.59
16 0.65
17 0.71
18 0.78
19 0.84
20 0.88
21 0.88
22 0.88
23 0.88
24 0.87
25 0.88
26 0.86
27 0.85
28 0.79
29 0.74
30 0.66
31 0.6
32 0.5
33 0.4
34 0.32
35 0.24
36 0.2
37 0.14
38 0.11
39 0.09
40 0.09
41 0.08
42 0.08
43 0.07
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.11
50 0.12
51 0.13
52 0.16
53 0.16
54 0.18
55 0.2
56 0.2
57 0.2
58 0.2
59 0.21
60 0.18
61 0.17
62 0.16
63 0.14
64 0.13
65 0.12
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.08
74 0.09
75 0.16
76 0.18
77 0.19
78 0.25
79 0.29
80 0.35
81 0.36
82 0.4
83 0.37
84 0.42
85 0.43
86 0.42
87 0.42
88 0.43
89 0.45
90 0.49
91 0.51
92 0.53
93 0.61
94 0.64
95 0.65
96 0.68
97 0.7
98 0.66
99 0.64
100 0.63
101 0.55
102 0.5
103 0.45
104 0.38
105 0.34
106 0.3
107 0.25
108 0.19
109 0.17
110 0.15
111 0.14
112 0.11
113 0.1
114 0.1
115 0.12
116 0.14
117 0.17
118 0.18
119 0.18
120 0.19
121 0.19
122 0.19
123 0.17
124 0.16
125 0.12
126 0.12
127 0.13
128 0.13
129 0.18
130 0.24
131 0.31
132 0.33
133 0.34
134 0.35
135 0.36
136 0.35
137 0.31
138 0.26
139 0.18
140 0.18
141 0.16
142 0.14
143 0.13
144 0.12
145 0.11
146 0.11
147 0.11
148 0.14
149 0.16
150 0.18
151 0.2
152 0.2
153 0.2
154 0.19
155 0.2
156 0.15
157 0.13
158 0.11
159 0.1
160 0.13
161 0.15
162 0.17
163 0.17
164 0.16
165 0.16
166 0.18
167 0.16
168 0.14
169 0.12
170 0.16
171 0.15
172 0.16
173 0.17
174 0.18
175 0.17
176 0.18
177 0.18
178 0.12
179 0.12
180 0.1
181 0.09
182 0.06
183 0.06
184 0.04
185 0.05
186 0.06
187 0.06
188 0.08
189 0.13
190 0.2
191 0.28
192 0.33
193 0.41
194 0.49
195 0.59
196 0.65
197 0.71
198 0.71
199 0.71
200 0.69
201 0.63
202 0.55
203 0.46
204 0.39
205 0.29
206 0.21
207 0.13
208 0.1
209 0.07
210 0.06
211 0.05
212 0.04
213 0.04
214 0.05
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.07
223 0.1
224 0.12
225 0.12
226 0.13
227 0.14
228 0.16
229 0.18
230 0.17
231 0.14
232 0.13
233 0.13
234 0.12
235 0.11
236 0.09
237 0.08
238 0.08
239 0.08
240 0.1
241 0.1
242 0.13
243 0.14
244 0.15
245 0.19
246 0.21
247 0.2
248 0.2
249 0.2
250 0.18
251 0.22
252 0.22
253 0.19
254 0.18
255 0.19
256 0.17
257 0.17
258 0.16
259 0.11
260 0.1
261 0.07
262 0.07
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.05
272 0.06
273 0.06
274 0.07
275 0.09
276 0.13
277 0.13
278 0.18
279 0.2
280 0.22
281 0.27
282 0.35
283 0.39
284 0.39
285 0.45
286 0.46
287 0.47
288 0.45
289 0.41
290 0.31
291 0.27
292 0.23
293 0.16
294 0.11
295 0.08
296 0.06
297 0.05
298 0.05
299 0.05
300 0.05
301 0.05
302 0.04
303 0.05
304 0.05
305 0.07
306 0.07
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.08
313 0.07
314 0.13
315 0.2
316 0.23
317 0.31
318 0.34
319 0.39
320 0.47
321 0.58
322 0.62
323 0.65
324 0.74
325 0.77
326 0.84
327 0.9
328 0.92
329 0.93
330 0.93
331 0.93
332 0.92
333 0.9
334 0.86
335 0.84
336 0.84
337 0.82
338 0.77
339 0.7
340 0.6
341 0.52
342 0.46
343 0.38
344 0.29
345 0.2
346 0.14
347 0.14
348 0.13
349 0.12
350 0.12
351 0.1
352 0.1
353 0.1
354 0.09
355 0.06
356 0.07
357 0.09
358 0.1
359 0.1
360 0.11
361 0.12
362 0.12
363 0.17
364 0.2
365 0.23
366 0.25
367 0.32
368 0.33
369 0.32
370 0.34
371 0.29
372 0.27
373 0.24
374 0.2
375 0.13
376 0.12
377 0.12
378 0.09
379 0.08
380 0.07
381 0.04
382 0.04
383 0.05
384 0.05
385 0.05
386 0.05
387 0.05
388 0.05
389 0.06
390 0.09
391 0.09
392 0.09
393 0.1
394 0.13
395 0.13
396 0.14
397 0.13
398 0.11
399 0.1
400 0.13
401 0.14
402 0.12
403 0.12
404 0.13
405 0.15
406 0.19
407 0.23
408 0.25
409 0.26
410 0.32
411 0.39
412 0.46
413 0.45
414 0.46
415 0.44
416 0.43
417 0.49
418 0.51
419 0.54
420 0.54
421 0.59
422 0.57
423 0.64
424 0.66
425 0.67
426 0.66
427 0.65
428 0.62
429 0.6
430 0.58
431 0.55
432 0.51
433 0.47
434 0.45
435 0.42
436 0.4
437 0.45
438 0.49
439 0.45
440 0.43
441 0.39
442 0.34
443 0.3
444 0.33
445 0.3
446 0.31
447 0.32
448 0.33
449 0.33
450 0.33
451 0.32
452 0.27
453 0.27
454 0.21
455 0.21
456 0.21
457 0.2
458 0.19
459 0.19
460 0.17
461 0.16
462 0.26
463 0.28
464 0.3
465 0.36
466 0.37
467 0.4
468 0.46
469 0.44
470 0.4