Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N9J9

Protein Details
Accession A8N9J9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-28ELAGERTKNGKRKRLNPRDISLAHydrophilic
NLS Segment(s)
PositionSequence
16-18KRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR002119  Histone_H2A  
IPR032454  Histone_H2A_C  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG cci:CC1G_09034  -  
Pfam View protein in Pfam  
PF16211  Histone_H2A_C  
Amino Acid Sequences MAEIIELAGERTKNGKRKRLNPRDISLAIKGDIELNRLFPPWTVIREGGVVPHIHEQLLFKRPKRAPEVSPSTDDEDDDSDDDFEQHPRSYHIDLHQSQDPEQSQPVLASPSTRAILEAHPDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.56
4 0.67
5 0.77
6 0.82
7 0.86
8 0.85
9 0.81
10 0.8
11 0.72
12 0.66
13 0.57
14 0.48
15 0.37
16 0.29
17 0.24
18 0.2
19 0.18
20 0.17
21 0.14
22 0.14
23 0.14
24 0.15
25 0.15
26 0.11
27 0.15
28 0.14
29 0.16
30 0.16
31 0.16
32 0.16
33 0.17
34 0.17
35 0.13
36 0.13
37 0.11
38 0.09
39 0.12
40 0.12
41 0.1
42 0.11
43 0.11
44 0.14
45 0.21
46 0.24
47 0.22
48 0.31
49 0.33
50 0.38
51 0.43
52 0.44
53 0.4
54 0.45
55 0.52
56 0.46
57 0.47
58 0.44
59 0.41
60 0.36
61 0.33
62 0.25
63 0.18
64 0.16
65 0.13
66 0.12
67 0.08
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.11
74 0.11
75 0.13
76 0.17
77 0.18
78 0.21
79 0.24
80 0.31
81 0.32
82 0.36
83 0.38
84 0.36
85 0.35
86 0.36
87 0.33
88 0.27
89 0.27
90 0.23
91 0.19
92 0.18
93 0.18
94 0.15
95 0.14
96 0.13
97 0.14
98 0.17
99 0.17
100 0.17
101 0.17
102 0.17
103 0.19