Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B932

Protein Details
Accession A0A2V1B932    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-39RFSHTYKMPNKPIKQRYKIFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences YYSPLLEVSINELMVRCFGRFSHTYKMPNKPIKQRYKIFGIADYGYLYNWVWSFRAKGLQALFKHPNLTLTGFFVRSLALFLPRNSFAIYFDNYFTFVPLFEELRTCGFSTVSTTRPHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.11
4 0.1
5 0.1
6 0.16
7 0.19
8 0.23
9 0.3
10 0.35
11 0.43
12 0.49
13 0.58
14 0.62
15 0.68
16 0.71
17 0.72
18 0.76
19 0.79
20 0.8
21 0.77
22 0.72
23 0.69
24 0.67
25 0.58
26 0.5
27 0.42
28 0.34
29 0.29
30 0.25
31 0.18
32 0.12
33 0.12
34 0.1
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.09
41 0.09
42 0.13
43 0.12
44 0.15
45 0.16
46 0.22
47 0.22
48 0.27
49 0.28
50 0.25
51 0.26
52 0.23
53 0.23
54 0.19
55 0.2
56 0.14
57 0.14
58 0.15
59 0.14
60 0.14
61 0.13
62 0.11
63 0.09
64 0.1
65 0.07
66 0.1
67 0.12
68 0.13
69 0.16
70 0.17
71 0.18
72 0.18
73 0.18
74 0.15
75 0.17
76 0.19
77 0.17
78 0.17
79 0.17
80 0.17
81 0.17
82 0.16
83 0.12
84 0.1
85 0.11
86 0.12
87 0.13
88 0.11
89 0.13
90 0.14
91 0.16
92 0.18
93 0.16
94 0.15
95 0.14
96 0.14
97 0.19
98 0.22
99 0.23