Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CBF1

Protein Details
Accession A0A2V1CBF1   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-107HIKIVKQRGKGAPKKKRTAEESKKFKGKKRBasic
NLS Segment(s)
PositionSequence
82-107VKQRGKGAPKKKRTAEESKKFKGKKR
Subcellular Location(s) nucl 14, mito 10.5, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAVPRARILDLMKVQCKIFSTTFNPEALRLGNKVLRQRLKGPALAAYYPRKVATIKDLQKLYPDWETWDDAEEDRLEHIKIVKQRGKGAPKKKRTAEESKKFKGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.37
4 0.33
5 0.28
6 0.27
7 0.28
8 0.33
9 0.36
10 0.36
11 0.34
12 0.3
13 0.3
14 0.26
15 0.23
16 0.16
17 0.17
18 0.19
19 0.22
20 0.27
21 0.33
22 0.37
23 0.38
24 0.41
25 0.46
26 0.46
27 0.44
28 0.39
29 0.34
30 0.31
31 0.29
32 0.28
33 0.24
34 0.22
35 0.21
36 0.2
37 0.17
38 0.16
39 0.15
40 0.18
41 0.24
42 0.27
43 0.32
44 0.32
45 0.32
46 0.33
47 0.33
48 0.3
49 0.23
50 0.19
51 0.17
52 0.18
53 0.19
54 0.17
55 0.18
56 0.16
57 0.14
58 0.15
59 0.12
60 0.1
61 0.1
62 0.11
63 0.1
64 0.1
65 0.12
66 0.15
67 0.2
68 0.29
69 0.33
70 0.35
71 0.43
72 0.5
73 0.59
74 0.64
75 0.7
76 0.71
77 0.76
78 0.83
79 0.83
80 0.83
81 0.81
82 0.83
83 0.83
84 0.83
85 0.83
86 0.83
87 0.85