Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1C0J6

Protein Details
Accession A0A2V1C0J6    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-88DKVYSHKKKQCIPKNQCKKKYYKKNVRRSLKQRNHDSDSDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, nucl 2, mito 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MQLSKLFTVLLITMGVAAAPAANPEPAPGGALEAAAPIEERNLHKCGKDKVYSHKKKQCIPKNQCKKKYYKKNVRRSLKQRNHDSDSDDSSCSDSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.04
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.05
11 0.06
12 0.08
13 0.07
14 0.08
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.05
21 0.05
22 0.04
23 0.04
24 0.03
25 0.04
26 0.06
27 0.07
28 0.11
29 0.13
30 0.15
31 0.16
32 0.21
33 0.25
34 0.29
35 0.33
36 0.32
37 0.41
38 0.51
39 0.59
40 0.64
41 0.67
42 0.67
43 0.68
44 0.76
45 0.75
46 0.75
47 0.76
48 0.77
49 0.81
50 0.87
51 0.89
52 0.85
53 0.86
54 0.86
55 0.87
56 0.88
57 0.88
58 0.88
59 0.89
60 0.93
61 0.93
62 0.93
63 0.92
64 0.92
65 0.91
66 0.9
67 0.9
68 0.88
69 0.84
70 0.76
71 0.7
72 0.64
73 0.6
74 0.53
75 0.43
76 0.35
77 0.31