Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BKV0

Protein Details
Accession A0A2V1BKV0   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-54RSCPNCKKNVKHISKGQRKRKIGBasic
NLS Segment(s)
PositionSequence
45-52SKGQRKRK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0016740  F:transferase activity  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
CDD cd00296  SIR2  
Amino Acid Sequences VRLQGRIDQLRCTQCNHTSQFEPLPVSGAGLRSCPNCKKNVKHISKGQRKRKIGLLRPDVLLYNEPDPNEKFVRDSMSHDIEEYPDLVLVAGMNTASENILGLVQGARNRGAKTFWVNKEEPSSKLKPLFDNVYQGDCDAIARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.51
4 0.49
5 0.43
6 0.46
7 0.44
8 0.41
9 0.37
10 0.29
11 0.27
12 0.22
13 0.21
14 0.18
15 0.16
16 0.14
17 0.13
18 0.15
19 0.15
20 0.22
21 0.28
22 0.3
23 0.36
24 0.44
25 0.5
26 0.58
27 0.67
28 0.69
29 0.69
30 0.76
31 0.79
32 0.81
33 0.85
34 0.84
35 0.83
36 0.79
37 0.74
38 0.73
39 0.72
40 0.7
41 0.69
42 0.65
43 0.58
44 0.55
45 0.52
46 0.44
47 0.35
48 0.28
49 0.19
50 0.15
51 0.14
52 0.13
53 0.15
54 0.15
55 0.17
56 0.17
57 0.15
58 0.14
59 0.13
60 0.17
61 0.16
62 0.19
63 0.2
64 0.22
65 0.22
66 0.21
67 0.2
68 0.17
69 0.16
70 0.13
71 0.08
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.03
89 0.04
90 0.04
91 0.06
92 0.08
93 0.09
94 0.12
95 0.15
96 0.15
97 0.16
98 0.18
99 0.2
100 0.26
101 0.35
102 0.37
103 0.41
104 0.41
105 0.43
106 0.51
107 0.5
108 0.45
109 0.43
110 0.41
111 0.41
112 0.46
113 0.46
114 0.41
115 0.44
116 0.48
117 0.43
118 0.47
119 0.43
120 0.4
121 0.37
122 0.33
123 0.28
124 0.21