Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CRZ4

Protein Details
Accession A0A2V1CRZ4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
111-130ADKLKNKLFKKKAVEKEPVTHydrophilic
NLS Segment(s)
PositionSequence
120-121KK
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 7.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSAKNSMEVSHGRGGAGNIGPDATQYTDGEIVREGIVGEHGDGAFSTGRGGAANIGSPGMKATKRKDDMAIPEVALRPSMEDQTFHTGRGGGGNIHKPDPPTGPKHPIGFADKLKNKLFKKKAVEKEPVTETTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.17
5 0.12
6 0.12
7 0.12
8 0.11
9 0.12
10 0.09
11 0.1
12 0.09
13 0.11
14 0.14
15 0.14
16 0.14
17 0.13
18 0.13
19 0.11
20 0.11
21 0.09
22 0.06
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.06
38 0.05
39 0.05
40 0.06
41 0.05
42 0.06
43 0.05
44 0.05
45 0.06
46 0.07
47 0.09
48 0.13
49 0.17
50 0.25
51 0.28
52 0.3
53 0.31
54 0.32
55 0.35
56 0.34
57 0.31
58 0.22
59 0.21
60 0.2
61 0.18
62 0.15
63 0.1
64 0.09
65 0.09
66 0.11
67 0.1
68 0.1
69 0.12
70 0.19
71 0.2
72 0.19
73 0.18
74 0.16
75 0.16
76 0.17
77 0.15
78 0.1
79 0.14
80 0.19
81 0.21
82 0.21
83 0.23
84 0.22
85 0.24
86 0.28
87 0.3
88 0.31
89 0.35
90 0.41
91 0.44
92 0.45
93 0.45
94 0.43
95 0.43
96 0.42
97 0.42
98 0.45
99 0.46
100 0.5
101 0.54
102 0.58
103 0.58
104 0.63
105 0.65
106 0.63
107 0.68
108 0.73
109 0.78
110 0.78
111 0.82
112 0.76
113 0.75
114 0.72