Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1C434

Protein Details
Accession A0A2V1C434    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-54PSNSKTVRSHVMKKYRQQRKAEKRSRPPLGRYKVPFHydrophilic
NLS Segment(s)
PositionSequence
31-46KKYRQQRKAEKRSRPP
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MNSELTFVNFSGSPQHGNPSNSKTVRSHVMKKYRQQRKAEKRSRPPLGRYKVPFYDSGIFSRPAKVQGTPPKLELPKVENVLSAEVSPKSSSTPDSTDFDDIEEIERTEIFSEPLKNSSLAPLAFLDTRLNGFNFLPIYASPRVLMLLHTNISSTIRTSVHADPSEKYLSYYVDNAARLYIALSYSATRFQDKTGNGPSESLYYLQKSISAVNDDITDPLKQASDSTIATVASMANIENLNGDPETAVVHLNGLKRMVEMRGGLSCLGMRGILQRVVLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.3
4 0.33
5 0.39
6 0.39
7 0.47
8 0.45
9 0.49
10 0.45
11 0.44
12 0.5
13 0.52
14 0.55
15 0.55
16 0.64
17 0.68
18 0.75
19 0.81
20 0.82
21 0.83
22 0.84
23 0.85
24 0.86
25 0.89
26 0.9
27 0.9
28 0.9
29 0.92
30 0.92
31 0.89
32 0.86
33 0.85
34 0.83
35 0.82
36 0.76
37 0.73
38 0.68
39 0.62
40 0.55
41 0.5
42 0.48
43 0.41
44 0.38
45 0.34
46 0.31
47 0.29
48 0.32
49 0.28
50 0.25
51 0.25
52 0.24
53 0.29
54 0.37
55 0.43
56 0.42
57 0.42
58 0.46
59 0.45
60 0.45
61 0.4
62 0.34
63 0.33
64 0.34
65 0.32
66 0.26
67 0.26
68 0.25
69 0.22
70 0.17
71 0.14
72 0.11
73 0.12
74 0.11
75 0.1
76 0.1
77 0.11
78 0.13
79 0.14
80 0.17
81 0.19
82 0.21
83 0.23
84 0.23
85 0.22
86 0.2
87 0.17
88 0.14
89 0.12
90 0.11
91 0.09
92 0.08
93 0.07
94 0.07
95 0.08
96 0.08
97 0.07
98 0.09
99 0.11
100 0.12
101 0.13
102 0.14
103 0.14
104 0.14
105 0.14
106 0.15
107 0.12
108 0.12
109 0.11
110 0.11
111 0.1
112 0.11
113 0.1
114 0.08
115 0.09
116 0.09
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.08
123 0.08
124 0.07
125 0.11
126 0.11
127 0.11
128 0.1
129 0.09
130 0.1
131 0.09
132 0.1
133 0.08
134 0.09
135 0.09
136 0.09
137 0.09
138 0.09
139 0.1
140 0.09
141 0.08
142 0.09
143 0.09
144 0.1
145 0.14
146 0.16
147 0.2
148 0.21
149 0.22
150 0.2
151 0.24
152 0.25
153 0.2
154 0.19
155 0.15
156 0.15
157 0.14
158 0.15
159 0.13
160 0.14
161 0.14
162 0.14
163 0.13
164 0.11
165 0.1
166 0.09
167 0.08
168 0.05
169 0.05
170 0.06
171 0.06
172 0.07
173 0.1
174 0.11
175 0.13
176 0.13
177 0.15
178 0.2
179 0.2
180 0.25
181 0.29
182 0.31
183 0.29
184 0.3
185 0.29
186 0.24
187 0.24
188 0.2
189 0.15
190 0.14
191 0.14
192 0.13
193 0.14
194 0.13
195 0.14
196 0.14
197 0.16
198 0.15
199 0.15
200 0.16
201 0.15
202 0.15
203 0.15
204 0.13
205 0.1
206 0.1
207 0.1
208 0.09
209 0.09
210 0.1
211 0.12
212 0.12
213 0.13
214 0.14
215 0.13
216 0.13
217 0.13
218 0.1
219 0.07
220 0.07
221 0.06
222 0.07
223 0.07
224 0.07
225 0.08
226 0.08
227 0.1
228 0.09
229 0.09
230 0.07
231 0.07
232 0.09
233 0.08
234 0.08
235 0.06
236 0.08
237 0.11
238 0.14
239 0.15
240 0.16
241 0.15
242 0.16
243 0.18
244 0.18
245 0.18
246 0.17
247 0.18
248 0.19
249 0.2
250 0.19
251 0.18
252 0.17
253 0.14
254 0.13
255 0.1
256 0.09
257 0.12
258 0.16
259 0.17