Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BEZ5

Protein Details
Accession A0A2V1BEZ5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-36PRISLPKKTETPPKKKKSLKKTPTQQMTTFHydrophilic
NLS Segment(s)
PositionSequence
13-27KKTETPPKKKKSLKK
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MRMTATPRISLPKKTETPPKKKKSLKKTPTQQMTTFQSQTHHPRATPSTILRFTRPFPGLHWSIYLHPPGDTIGKSHDVWYHPDSRTWERKTLFVEYVRDDTLIWDNRMTAERYLGWTEIGDVEDVEEFERVMEERSVPEGVDEDQNCQAWVRNVIVNAWWRGLLARMRLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.65
4 0.72
5 0.76
6 0.8
7 0.81
8 0.85
9 0.89
10 0.89
11 0.9
12 0.89
13 0.89
14 0.9
15 0.9
16 0.9
17 0.86
18 0.78
19 0.73
20 0.7
21 0.66
22 0.57
23 0.47
24 0.39
25 0.39
26 0.44
27 0.45
28 0.4
29 0.34
30 0.37
31 0.4
32 0.42
33 0.41
34 0.36
35 0.36
36 0.39
37 0.41
38 0.39
39 0.37
40 0.35
41 0.38
42 0.35
43 0.29
44 0.25
45 0.3
46 0.28
47 0.26
48 0.26
49 0.2
50 0.21
51 0.23
52 0.22
53 0.16
54 0.14
55 0.13
56 0.13
57 0.13
58 0.11
59 0.09
60 0.11
61 0.13
62 0.14
63 0.15
64 0.17
65 0.16
66 0.2
67 0.22
68 0.26
69 0.23
70 0.26
71 0.29
72 0.32
73 0.39
74 0.38
75 0.41
76 0.36
77 0.38
78 0.38
79 0.38
80 0.34
81 0.29
82 0.28
83 0.24
84 0.26
85 0.23
86 0.21
87 0.17
88 0.15
89 0.18
90 0.19
91 0.17
92 0.15
93 0.15
94 0.16
95 0.18
96 0.18
97 0.13
98 0.12
99 0.12
100 0.14
101 0.16
102 0.14
103 0.13
104 0.11
105 0.11
106 0.1
107 0.1
108 0.08
109 0.06
110 0.06
111 0.06
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.06
118 0.05
119 0.07
120 0.08
121 0.08
122 0.09
123 0.12
124 0.13
125 0.12
126 0.12
127 0.11
128 0.12
129 0.18
130 0.17
131 0.18
132 0.2
133 0.21
134 0.21
135 0.2
136 0.21
137 0.17
138 0.2
139 0.2
140 0.2
141 0.2
142 0.21
143 0.24
144 0.27
145 0.26
146 0.24
147 0.21
148 0.19
149 0.19
150 0.23
151 0.24
152 0.22