Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B1F1

Protein Details
Accession A0A2V1B1F1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-57TPFTNKSRFTRRRARNSQRKLIRQTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences VIDSEGNLSIPSEKVINTPTLTSKSPYKSKLTPFTNKSRFTRRRARNSQRKLIRQTFFQKLSQKPSNITQNKQQPFTSFFTPKPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.16
4 0.15
5 0.17
6 0.19
7 0.22
8 0.23
9 0.24
10 0.28
11 0.31
12 0.36
13 0.39
14 0.41
15 0.43
16 0.49
17 0.56
18 0.56
19 0.59
20 0.58
21 0.64
22 0.66
23 0.66
24 0.63
25 0.65
26 0.65
27 0.63
28 0.69
29 0.67
30 0.71
31 0.76
32 0.83
33 0.83
34 0.84
35 0.86
36 0.85
37 0.83
38 0.81
39 0.79
40 0.7
41 0.66
42 0.64
43 0.62
44 0.57
45 0.54
46 0.53
47 0.49
48 0.56
49 0.55
50 0.51
51 0.46
52 0.5
53 0.56
54 0.54
55 0.54
56 0.54
57 0.58
58 0.61
59 0.62
60 0.56
61 0.49
62 0.49
63 0.5
64 0.48
65 0.43
66 0.42