Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1C9M7

Protein Details
Accession A0A2V1C9M7    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-31VPNKQRKTASRAKVQKRNAANKVHydrophilic
NLS Segment(s)
PositionSequence
12-36KQRKTASRAKVQKRNAANKVSKNPR
56-65GKKARKLQKL
70-70R
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
Amino Acid Sequences MPSRGNPNVPNKQRKTASRAKVQKRNAANKVSKNPRGTARSDVLHPTSGPLAPVSGKKARKLQKLQNNARRRAIEKAMEQEGEVEMTDAPKTTKAKAKPEKPTDDQMEVDAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.73
4 0.72
5 0.72
6 0.77
7 0.78
8 0.8
9 0.8
10 0.8
11 0.8
12 0.81
13 0.77
14 0.76
15 0.73
16 0.72
17 0.75
18 0.76
19 0.74
20 0.67
21 0.63
22 0.62
23 0.58
24 0.53
25 0.49
26 0.43
27 0.38
28 0.36
29 0.36
30 0.3
31 0.27
32 0.23
33 0.19
34 0.16
35 0.14
36 0.12
37 0.09
38 0.08
39 0.08
40 0.09
41 0.12
42 0.18
43 0.19
44 0.22
45 0.3
46 0.37
47 0.45
48 0.52
49 0.57
50 0.59
51 0.69
52 0.76
53 0.78
54 0.79
55 0.75
56 0.73
57 0.67
58 0.6
59 0.55
60 0.5
61 0.45
62 0.4
63 0.4
64 0.37
65 0.34
66 0.32
67 0.27
68 0.22
69 0.17
70 0.13
71 0.09
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.12
78 0.14
79 0.18
80 0.26
81 0.32
82 0.43
83 0.52
84 0.61
85 0.67
86 0.75
87 0.79
88 0.77
89 0.8
90 0.75
91 0.69
92 0.61
93 0.51