Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B7G6

Protein Details
Accession A0A2V1B7G6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
10-31TYRACTKADKHTKKRTLWNYCEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 5, cyto 3.5, pero 2
Family & Domain DBs
Amino Acid Sequences MCTYVEHIQTYRACTKADKHTKKRTLWNYCERSNNIDPCNDTSPDPDMVLGSSTIPGGCPVCANPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.4
4 0.49
5 0.54
6 0.59
7 0.68
8 0.76
9 0.79
10 0.83
11 0.82
12 0.81
13 0.79
14 0.79
15 0.75
16 0.7
17 0.7
18 0.62
19 0.58
20 0.53
21 0.49
22 0.4
23 0.35
24 0.33
25 0.31
26 0.33
27 0.27
28 0.22
29 0.2
30 0.21
31 0.21
32 0.19
33 0.15
34 0.12
35 0.11
36 0.11
37 0.1
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1