Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CKE7

Protein Details
Accession A0A2V1CKE7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRDSRSALSWRRDRRKKEVKEVKGKKEQGQBasic
NLS Segment(s)
PositionSequence
11-26RRDRRKKEVKEVKGKK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRDSRSALSWRRDRRKKEVKEVKGKKEQGQGTVGVCLYLSRGRGRVAKGERVLCRVLKVGPAGQGTSVSGVSYSWESGDPDQAFRVGSGLAAAGGWRKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.84
4 0.87
5 0.87
6 0.86
7 0.88
8 0.9
9 0.88
10 0.88
11 0.83
12 0.78
13 0.75
14 0.67
15 0.6
16 0.52
17 0.45
18 0.35
19 0.32
20 0.26
21 0.17
22 0.14
23 0.1
24 0.09
25 0.09
26 0.1
27 0.09
28 0.11
29 0.13
30 0.17
31 0.18
32 0.24
33 0.26
34 0.3
35 0.33
36 0.37
37 0.36
38 0.36
39 0.36
40 0.29
41 0.26
42 0.22
43 0.19
44 0.15
45 0.16
46 0.14
47 0.15
48 0.16
49 0.15
50 0.14
51 0.14
52 0.12
53 0.12
54 0.1
55 0.06
56 0.06
57 0.05
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.1
64 0.11
65 0.18
66 0.17
67 0.18
68 0.18
69 0.18
70 0.17
71 0.16
72 0.16
73 0.09
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.06