Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BL34

Protein Details
Accession A0A2V1BL34   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSLPPQKLPRRHAQRRTLYHGRHKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSLPPQKLPRRHAQRRTLYHGRHKTPPLDLSSAENPQAIKPQAKKRQKVPISNANDSSAASDSDSDSDSESDSGYSSNRYLDSEAEHYRKIRAEFVVAGPNLANPCDETKAMMKREEQMWKLHCKKIRKGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.87
4 0.86
5 0.83
6 0.83
7 0.82
8 0.77
9 0.75
10 0.72
11 0.66
12 0.61
13 0.58
14 0.52
15 0.45
16 0.4
17 0.38
18 0.36
19 0.35
20 0.3
21 0.26
22 0.22
23 0.2
24 0.24
25 0.21
26 0.23
27 0.28
28 0.38
29 0.47
30 0.56
31 0.61
32 0.63
33 0.71
34 0.73
35 0.75
36 0.72
37 0.71
38 0.7
39 0.68
40 0.61
41 0.52
42 0.45
43 0.36
44 0.3
45 0.21
46 0.13
47 0.09
48 0.08
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.06
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.09
68 0.1
69 0.12
70 0.16
71 0.2
72 0.22
73 0.23
74 0.23
75 0.24
76 0.27
77 0.26
78 0.24
79 0.2
80 0.21
81 0.21
82 0.22
83 0.27
84 0.23
85 0.22
86 0.19
87 0.19
88 0.17
89 0.16
90 0.14
91 0.09
92 0.12
93 0.14
94 0.14
95 0.15
96 0.21
97 0.28
98 0.31
99 0.33
100 0.33
101 0.35
102 0.42
103 0.47
104 0.43
105 0.44
106 0.46
107 0.54
108 0.58
109 0.61
110 0.61
111 0.61