Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BIF8

Protein Details
Accession A0A2V1BIF8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-116GEKAKVTKTKGGPKGKARGKBasic
NLS Segment(s)
PositionSequence
99-116KAKVTKTKGGPKGKARGK
Subcellular Location(s) cyto 11.5, cyto_mito 10.5, mito 8.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MSQQEDEDPMREKLKASLWFSIGKMVDEEAALLNTTATPQFIGAMTEMVWAQLENAAIDLEAFSRHAGRTTITTDDVLLMTRKNEALQGILKNFVEGEKAKVTKTKGGPKGKARGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.34
4 0.35
5 0.35
6 0.37
7 0.36
8 0.38
9 0.32
10 0.25
11 0.21
12 0.17
13 0.16
14 0.13
15 0.13
16 0.08
17 0.07
18 0.07
19 0.06
20 0.06
21 0.05
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.04
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.09
57 0.12
58 0.13
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.1
72 0.09
73 0.12
74 0.15
75 0.19
76 0.19
77 0.22
78 0.21
79 0.2
80 0.19
81 0.17
82 0.17
83 0.14
84 0.17
85 0.21
86 0.22
87 0.24
88 0.29
89 0.32
90 0.36
91 0.44
92 0.5
93 0.52
94 0.61
95 0.69
96 0.73