Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BCK9

Protein Details
Accession A0A2V1BCK9    Localization Confidence High Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-183DHVPRDKKFRLRRRAMQLSEBasic
229-250STSASDSPTKRKRQQSPPLVSSHydrophilic
255-281LPAARPPKLEYRRGKRRRVSVEEHMDKBasic
NLS Segment(s)
PositionSequence
257-272AARPPKLEYRRGKRRR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSQLTTPGTETFSHEIVDLSIDFNSQLTGEDAPFDGDIDINDFHALPINPQLTQVTITEPSTSLSPVSELASTTSTSENSDLVGINSISPVEPSRAQLKIEEQLVFICHKVQKEFLSKDEPAKAENMSAIDRYFGKVEDMHHIPYDSKAARKLYKVLAAILELDHVPRDKKFRLRRRAMQLSEKLESLRREGESLNRLSENGIIDTPAKLTHSNVNEVLGLAVSQEITSTSASDSPTKRKRQQSPPLVSSDRHALPAARPPKLEYRRGKRRRVSVEEHMDKEQSAMQSSYDHVCELLTEVDEDIARAKARRLRLEKWKEDLVVWGREERNFKDRLEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.18
5 0.13
6 0.1
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.07
13 0.07
14 0.08
15 0.09
16 0.09
17 0.1
18 0.11
19 0.12
20 0.11
21 0.11
22 0.1
23 0.08
24 0.08
25 0.1
26 0.1
27 0.09
28 0.1
29 0.09
30 0.09
31 0.14
32 0.14
33 0.12
34 0.19
35 0.19
36 0.19
37 0.2
38 0.2
39 0.16
40 0.18
41 0.17
42 0.14
43 0.15
44 0.16
45 0.16
46 0.15
47 0.15
48 0.15
49 0.15
50 0.11
51 0.1
52 0.1
53 0.09
54 0.11
55 0.1
56 0.09
57 0.11
58 0.11
59 0.11
60 0.12
61 0.12
62 0.12
63 0.13
64 0.13
65 0.11
66 0.11
67 0.11
68 0.1
69 0.09
70 0.11
71 0.09
72 0.08
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.09
79 0.1
80 0.13
81 0.17
82 0.18
83 0.19
84 0.2
85 0.22
86 0.23
87 0.25
88 0.23
89 0.19
90 0.18
91 0.19
92 0.18
93 0.15
94 0.15
95 0.14
96 0.15
97 0.16
98 0.18
99 0.22
100 0.29
101 0.31
102 0.31
103 0.35
104 0.35
105 0.37
106 0.39
107 0.35
108 0.27
109 0.27
110 0.24
111 0.18
112 0.17
113 0.15
114 0.11
115 0.11
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.1
124 0.11
125 0.16
126 0.17
127 0.17
128 0.17
129 0.17
130 0.16
131 0.16
132 0.19
133 0.15
134 0.15
135 0.18
136 0.21
137 0.24
138 0.25
139 0.28
140 0.25
141 0.29
142 0.28
143 0.24
144 0.21
145 0.18
146 0.17
147 0.13
148 0.11
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.08
155 0.12
156 0.15
157 0.24
158 0.34
159 0.44
160 0.54
161 0.62
162 0.69
163 0.74
164 0.8
165 0.75
166 0.74
167 0.7
168 0.63
169 0.56
170 0.48
171 0.39
172 0.33
173 0.3
174 0.24
175 0.2
176 0.16
177 0.16
178 0.17
179 0.21
180 0.22
181 0.23
182 0.22
183 0.2
184 0.19
185 0.18
186 0.2
187 0.16
188 0.12
189 0.1
190 0.09
191 0.09
192 0.1
193 0.09
194 0.08
195 0.08
196 0.08
197 0.09
198 0.15
199 0.16
200 0.19
201 0.19
202 0.2
203 0.18
204 0.18
205 0.16
206 0.1
207 0.08
208 0.05
209 0.04
210 0.03
211 0.03
212 0.03
213 0.04
214 0.05
215 0.05
216 0.06
217 0.06
218 0.08
219 0.1
220 0.16
221 0.18
222 0.27
223 0.36
224 0.45
225 0.53
226 0.6
227 0.69
228 0.74
229 0.82
230 0.83
231 0.83
232 0.79
233 0.78
234 0.71
235 0.61
236 0.53
237 0.48
238 0.38
239 0.31
240 0.27
241 0.21
242 0.2
243 0.29
244 0.33
245 0.29
246 0.29
247 0.31
248 0.41
249 0.46
250 0.54
251 0.55
252 0.6
253 0.68
254 0.77
255 0.84
256 0.82
257 0.85
258 0.85
259 0.83
260 0.81
261 0.8
262 0.81
263 0.78
264 0.73
265 0.66
266 0.56
267 0.48
268 0.41
269 0.34
270 0.24
271 0.2
272 0.17
273 0.15
274 0.15
275 0.18
276 0.19
277 0.16
278 0.15
279 0.13
280 0.12
281 0.12
282 0.12
283 0.11
284 0.09
285 0.09
286 0.09
287 0.1
288 0.1
289 0.1
290 0.1
291 0.11
292 0.12
293 0.13
294 0.18
295 0.23
296 0.31
297 0.41
298 0.46
299 0.53
300 0.62
301 0.72
302 0.74
303 0.75
304 0.73
305 0.64
306 0.58
307 0.58
308 0.53
309 0.48
310 0.42
311 0.43
312 0.39
313 0.43
314 0.47
315 0.44
316 0.45
317 0.42