Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BAN4

Protein Details
Accession A0A2V1BAN4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25PSEPNHSKKYDPKKLRITEEPFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015876  Acyl-CoA_DS  
Gene Ontology GO:0016020  C:membrane  
GO:0016717  F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water  
GO:0006633  P:fatty acid biosynthetic process  
Amino Acid Sequences MVEPSEPNHSKKYDPKKLRITEEPFTRSTWYKHVNWLNVTLIVGLLMYGLIATYWTPLQLKTATWAIAYYFITSLGITAGTHVILRLLYSHFGWMIMKQNPKRIGRTDISDLNDDPVVVWQHRNYIQTVIFMGMILPCLVTGLGWGDWMGGFIYAGIVRIFFVQQATFCVNSLAHWLDDQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.76
4 0.81
5 0.82
6 0.82
7 0.78
8 0.75
9 0.74
10 0.69
11 0.6
12 0.54
13 0.5
14 0.44
15 0.4
16 0.4
17 0.38
18 0.35
19 0.43
20 0.48
21 0.5
22 0.48
23 0.48
24 0.42
25 0.36
26 0.34
27 0.24
28 0.17
29 0.12
30 0.09
31 0.06
32 0.04
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.04
41 0.04
42 0.05
43 0.06
44 0.06
45 0.09
46 0.1
47 0.1
48 0.12
49 0.14
50 0.13
51 0.13
52 0.13
53 0.11
54 0.12
55 0.13
56 0.1
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.12
83 0.15
84 0.22
85 0.23
86 0.3
87 0.37
88 0.39
89 0.42
90 0.4
91 0.42
92 0.38
93 0.4
94 0.38
95 0.36
96 0.35
97 0.34
98 0.3
99 0.25
100 0.23
101 0.18
102 0.14
103 0.12
104 0.11
105 0.1
106 0.12
107 0.11
108 0.15
109 0.18
110 0.19
111 0.18
112 0.2
113 0.2
114 0.19
115 0.19
116 0.16
117 0.13
118 0.11
119 0.1
120 0.07
121 0.07
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.04
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.07
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.08
148 0.07
149 0.09
150 0.09
151 0.09
152 0.13
153 0.16
154 0.16
155 0.16
156 0.17
157 0.15
158 0.15
159 0.2
160 0.18
161 0.15