Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1C792

Protein Details
Accession A0A2V1C792   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
125-151TTPTKVTKPRAPRKSKATKAKVKAEPEHydrophilic
NLS Segment(s)
PositionSequence
132-147KPRAPRKSKATKAKVK
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.499, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTLLYTTTFDLATQAQASLNTDIQNTSNNIAHPATMAETKAPRAPTEKEAFFFLTIMQCMTNKPEVDWDLVASRAGYSNANCAKVRFGQIKKAIGYKEDGSSIPTTNPVKGRAKKDTTVGSGTNTTPTKVTKPRAPRKSKATKAKVKAEPEAQIEIEQQYEEEVNEEVGEVAEDEADAYTFDNPLHEQLYNNYQEYHTSQYEDEDAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.15
5 0.15
6 0.16
7 0.15
8 0.15
9 0.16
10 0.16
11 0.19
12 0.18
13 0.18
14 0.19
15 0.18
16 0.21
17 0.2
18 0.19
19 0.16
20 0.15
21 0.14
22 0.13
23 0.13
24 0.13
25 0.15
26 0.17
27 0.21
28 0.21
29 0.2
30 0.23
31 0.27
32 0.31
33 0.36
34 0.36
35 0.33
36 0.35
37 0.34
38 0.3
39 0.26
40 0.2
41 0.15
42 0.13
43 0.13
44 0.11
45 0.09
46 0.1
47 0.13
48 0.16
49 0.14
50 0.15
51 0.18
52 0.19
53 0.21
54 0.2
55 0.18
56 0.15
57 0.15
58 0.15
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.15
66 0.17
67 0.2
68 0.2
69 0.2
70 0.21
71 0.22
72 0.26
73 0.27
74 0.26
75 0.31
76 0.35
77 0.39
78 0.37
79 0.39
80 0.35
81 0.28
82 0.29
83 0.23
84 0.19
85 0.17
86 0.16
87 0.14
88 0.15
89 0.14
90 0.11
91 0.14
92 0.14
93 0.15
94 0.16
95 0.2
96 0.27
97 0.32
98 0.37
99 0.41
100 0.45
101 0.44
102 0.46
103 0.45
104 0.4
105 0.37
106 0.32
107 0.26
108 0.24
109 0.22
110 0.23
111 0.2
112 0.17
113 0.16
114 0.16
115 0.21
116 0.26
117 0.3
118 0.32
119 0.43
120 0.53
121 0.63
122 0.69
123 0.71
124 0.74
125 0.8
126 0.83
127 0.83
128 0.83
129 0.82
130 0.81
131 0.84
132 0.81
133 0.74
134 0.7
135 0.63
136 0.57
137 0.51
138 0.45
139 0.36
140 0.3
141 0.26
142 0.22
143 0.18
144 0.13
145 0.1
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.05
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.06
168 0.06
169 0.08
170 0.09
171 0.11
172 0.13
173 0.13
174 0.14
175 0.18
176 0.25
177 0.28
178 0.28
179 0.27
180 0.25
181 0.28
182 0.3
183 0.33
184 0.26
185 0.25
186 0.24
187 0.26