Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BGJ5

Protein Details
Accession A0A2V1BGJ5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-38RRMDVSKLRTRERKGRKRRGKVDSENERIABasic
NLS Segment(s)
PositionSequence
15-29KLRTRERKGRKRRGK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MCTHTQVGRRMDVSKLRTRERKGRKRRGKVDSENERIAIGTRTMPNLDTSLSRFASPLVLLALQSMAGYINPCSATLQSHPHHPHHPHHPHHLYHSHHQQYQQYQQYQQYQQYQQYQQYQQYQQYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.54
4 0.6
5 0.65
6 0.7
7 0.74
8 0.78
9 0.81
10 0.86
11 0.88
12 0.9
13 0.93
14 0.92
15 0.91
16 0.9
17 0.9
18 0.88
19 0.84
20 0.75
21 0.65
22 0.55
23 0.44
24 0.35
25 0.26
26 0.16
27 0.13
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.13
34 0.13
35 0.11
36 0.12
37 0.15
38 0.15
39 0.14
40 0.13
41 0.13
42 0.13
43 0.11
44 0.1
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.09
63 0.1
64 0.17
65 0.17
66 0.25
67 0.3
68 0.32
69 0.39
70 0.42
71 0.46
72 0.5
73 0.58
74 0.55
75 0.61
76 0.63
77 0.58
78 0.6
79 0.61
80 0.56
81 0.55
82 0.6
83 0.56
84 0.53
85 0.55
86 0.55
87 0.54
88 0.58
89 0.58
90 0.51
91 0.49
92 0.53
93 0.57
94 0.56
95 0.56
96 0.54
97 0.51
98 0.54
99 0.58
100 0.56
101 0.55
102 0.58
103 0.56
104 0.55
105 0.58
106 0.56