Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BVZ1

Protein Details
Accession A0A2V1BVZ1   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-68LSWVSRRYTKPKPKKKVIVWVWHydrophilic
NLS Segment(s)
PositionSequence
56-61KPKPKK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDIRGYQPLSFGASSGPLEGSLFSLFSSYYIHQVVAATYYHISLARLSWVSRRYTKPKPKKKVIVWVWICCQCNASGMSLSIENCPGCSIERCTACEVRKQAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.09
5 0.09
6 0.09
7 0.1
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.1
15 0.09
16 0.11
17 0.11
18 0.11
19 0.11
20 0.12
21 0.11
22 0.1
23 0.09
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.12
36 0.14
37 0.17
38 0.22
39 0.27
40 0.33
41 0.42
42 0.53
43 0.6
44 0.68
45 0.75
46 0.8
47 0.84
48 0.83
49 0.83
50 0.78
51 0.78
52 0.72
53 0.66
54 0.62
55 0.58
56 0.53
57 0.42
58 0.37
59 0.26
60 0.24
61 0.21
62 0.17
63 0.13
64 0.13
65 0.14
66 0.14
67 0.15
68 0.13
69 0.15
70 0.13
71 0.12
72 0.12
73 0.12
74 0.13
75 0.15
76 0.2
77 0.25
78 0.28
79 0.31
80 0.36
81 0.42
82 0.42
83 0.46