Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BCV6

Protein Details
Accession A0A2V1BCV6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-31IKTSYTTTLRQNRRRERPGSRTRRTISRKHydrophilic
NLS Segment(s)
PositionSequence
15-26RRRERPGSRTRR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MAIKTSYTTTLRQNRRRERPGSRTRRTISRKANTLDDCDEGCPDSRDANPLPPSSKANPRPLLRQDFDQCWQRWKLRQVEEEAQTEMDRLLLEQEQQRLFGGDSGDDGSLCLAMLDVVMQLFGDIDYTDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.85
4 0.84
5 0.84
6 0.85
7 0.87
8 0.87
9 0.84
10 0.83
11 0.79
12 0.81
13 0.78
14 0.77
15 0.77
16 0.74
17 0.74
18 0.68
19 0.71
20 0.63
21 0.6
22 0.52
23 0.44
24 0.36
25 0.29
26 0.26
27 0.19
28 0.18
29 0.15
30 0.13
31 0.12
32 0.12
33 0.15
34 0.16
35 0.21
36 0.23
37 0.23
38 0.24
39 0.24
40 0.27
41 0.27
42 0.36
43 0.36
44 0.41
45 0.46
46 0.46
47 0.51
48 0.53
49 0.56
50 0.48
51 0.46
52 0.41
53 0.37
54 0.39
55 0.4
56 0.34
57 0.32
58 0.35
59 0.33
60 0.36
61 0.4
62 0.44
63 0.44
64 0.47
65 0.48
66 0.51
67 0.51
68 0.47
69 0.41
70 0.34
71 0.27
72 0.24
73 0.17
74 0.11
75 0.07
76 0.06
77 0.07
78 0.06
79 0.09
80 0.12
81 0.17
82 0.17
83 0.18
84 0.18
85 0.17
86 0.17
87 0.16
88 0.14
89 0.09
90 0.1
91 0.11
92 0.11
93 0.1
94 0.09
95 0.07
96 0.07
97 0.06
98 0.05
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.03
105 0.04
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04