Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CU31

Protein Details
Accession A0A2V1CU31   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-86KSPRLSFPPQENKRRKPFRQVEKICYCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 8.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCLFFRYSTYSDMRLSTSLLSLFLPLTSDISHSTPSPETGPAPSPPSHPIRLQISNHSHKSPRLSFPPQENKRRKPFRQVEKICYCGFCRHRSPTPLQHHTRIGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.17
5 0.14
6 0.13
7 0.12
8 0.1
9 0.1
10 0.08
11 0.09
12 0.07
13 0.08
14 0.08
15 0.09
16 0.1
17 0.11
18 0.13
19 0.12
20 0.14
21 0.13
22 0.15
23 0.15
24 0.14
25 0.13
26 0.14
27 0.16
28 0.15
29 0.18
30 0.18
31 0.19
32 0.21
33 0.25
34 0.25
35 0.24
36 0.26
37 0.27
38 0.32
39 0.31
40 0.34
41 0.37
42 0.41
43 0.43
44 0.41
45 0.38
46 0.35
47 0.4
48 0.37
49 0.35
50 0.36
51 0.39
52 0.41
53 0.48
54 0.57
55 0.59
56 0.66
57 0.7
58 0.72
59 0.77
60 0.83
61 0.78
62 0.79
63 0.8
64 0.81
65 0.82
66 0.81
67 0.8
68 0.77
69 0.77
70 0.67
71 0.6
72 0.52
73 0.5
74 0.48
75 0.45
76 0.45
77 0.48
78 0.54
79 0.58
80 0.64
81 0.65
82 0.7
83 0.73
84 0.73
85 0.71
86 0.68