Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B464

Protein Details
Accession A0A2V1B464    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-39DREPSSHLRTRRTTKRPKRNKSLVDEEVHydrophilic
NLS Segment(s)
PositionSequence
4-32RLVKKRSADREPSSHLRTRRTTKRPKRNK
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPRRLVKKRSADREPSSHLRTRRTTKRPKRNKSLVDEEVGDFIVVDTGTTGDTETIGETGTVEDTGTIRDTVAVEDENPTTSASVGSDAVGATLQGDGTTVQSKHRKLDTNSDATQKARDAFPLLPLKALPASHIYTMQNGLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.71
4 0.68
5 0.63
6 0.61
7 0.63
8 0.66
9 0.68
10 0.71
11 0.76
12 0.8
13 0.86
14 0.9
15 0.92
16 0.93
17 0.93
18 0.91
19 0.88
20 0.86
21 0.78
22 0.7
23 0.62
24 0.51
25 0.42
26 0.33
27 0.24
28 0.14
29 0.1
30 0.08
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.05
59 0.06
60 0.06
61 0.05
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.05
71 0.06
72 0.06
73 0.05
74 0.06
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.05
86 0.09
87 0.09
88 0.15
89 0.22
90 0.24
91 0.29
92 0.34
93 0.4
94 0.41
95 0.51
96 0.52
97 0.53
98 0.54
99 0.54
100 0.51
101 0.44
102 0.43
103 0.35
104 0.3
105 0.23
106 0.22
107 0.21
108 0.19
109 0.26
110 0.31
111 0.29
112 0.28
113 0.27
114 0.28
115 0.27
116 0.26
117 0.2
118 0.17
119 0.2
120 0.2
121 0.24
122 0.23
123 0.22
124 0.27