Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BRK3

Protein Details
Accession A0A2V1BRK3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-120GKIVRVRSREGRRNRAPPPRVRYNKDGKKVNPNQAAHydrophilic
NLS Segment(s)
PositionSequence
89-113RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences SESATMVKKRASNGRNKNGRGHVKPIRCSNCSRCTPKDKAIKRFTIRHVPSAAIRDISDASVFPEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVNPNQAAAKTTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.74
4 0.76
5 0.76
6 0.78
7 0.72
8 0.7
9 0.69
10 0.67
11 0.7
12 0.72
13 0.69
14 0.62
15 0.65
16 0.63
17 0.64
18 0.64
19 0.65
20 0.62
21 0.63
22 0.66
23 0.68
24 0.7
25 0.69
26 0.71
27 0.72
28 0.74
29 0.71
30 0.72
31 0.69
32 0.7
33 0.63
34 0.57
35 0.51
36 0.43
37 0.39
38 0.36
39 0.3
40 0.2
41 0.18
42 0.15
43 0.14
44 0.13
45 0.11
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.14
59 0.19
60 0.21
61 0.23
62 0.25
63 0.25
64 0.25
65 0.27
66 0.25
67 0.2
68 0.2
69 0.18
70 0.19
71 0.19
72 0.21
73 0.22
74 0.28
75 0.31
76 0.32
77 0.35
78 0.4
79 0.49
80 0.55
81 0.61
82 0.65
83 0.69
84 0.75
85 0.8
86 0.81
87 0.8
88 0.8
89 0.79
90 0.8
91 0.8
92 0.78
93 0.78
94 0.79
95 0.8
96 0.8
97 0.8
98 0.75
99 0.77
100 0.8
101 0.82
102 0.79
103 0.73
104 0.7
105 0.66
106 0.64