Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BRH3

Protein Details
Accession A0A2V1BRH3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
153-184RSGRPPAPTKITKRNRTNNKHRSAQRKSTHPMHydrophilic
NLS Segment(s)
PositionSequence
149-180IARVRSGRPPAPTKITKRNRTNNKHRSAQRKS
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MSEQLNKTLKPAVLPLTPPLLFPTTPPHLADLGGPGFEFRYSLTLGLKDEVDQQRGRQERYARFGADEEDLRLTTPSPLREAYRKLVEDDLNDTHTPSPSPPPSIRSIHDSDLRAATGMPASSKFRARGCTGATGHARNLVQGKGKQQIARVRSGRPPAPTKITKRNRTNNKHRSAQRKSTHPMTTRSKAQGSERHRLEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.3
5 0.28
6 0.28
7 0.26
8 0.22
9 0.22
10 0.27
11 0.26
12 0.28
13 0.28
14 0.27
15 0.25
16 0.25
17 0.24
18 0.21
19 0.16
20 0.14
21 0.13
22 0.11
23 0.11
24 0.1
25 0.1
26 0.06
27 0.08
28 0.08
29 0.1
30 0.11
31 0.12
32 0.13
33 0.14
34 0.14
35 0.12
36 0.2
37 0.22
38 0.25
39 0.24
40 0.24
41 0.31
42 0.35
43 0.36
44 0.34
45 0.38
46 0.4
47 0.45
48 0.48
49 0.4
50 0.37
51 0.36
52 0.32
53 0.26
54 0.21
55 0.16
56 0.14
57 0.13
58 0.13
59 0.12
60 0.1
61 0.11
62 0.13
63 0.13
64 0.14
65 0.15
66 0.17
67 0.22
68 0.25
69 0.26
70 0.29
71 0.29
72 0.28
73 0.3
74 0.29
75 0.25
76 0.26
77 0.22
78 0.2
79 0.19
80 0.18
81 0.15
82 0.14
83 0.14
84 0.11
85 0.15
86 0.13
87 0.17
88 0.17
89 0.2
90 0.24
91 0.26
92 0.27
93 0.27
94 0.29
95 0.28
96 0.32
97 0.3
98 0.26
99 0.25
100 0.23
101 0.18
102 0.15
103 0.12
104 0.08
105 0.07
106 0.06
107 0.07
108 0.1
109 0.12
110 0.15
111 0.17
112 0.19
113 0.22
114 0.24
115 0.26
116 0.25
117 0.3
118 0.28
119 0.32
120 0.33
121 0.31
122 0.29
123 0.3
124 0.27
125 0.22
126 0.23
127 0.2
128 0.22
129 0.23
130 0.27
131 0.29
132 0.33
133 0.33
134 0.36
135 0.41
136 0.39
137 0.45
138 0.44
139 0.42
140 0.45
141 0.5
142 0.48
143 0.48
144 0.5
145 0.47
146 0.52
147 0.56
148 0.58
149 0.62
150 0.68
151 0.72
152 0.77
153 0.82
154 0.85
155 0.88
156 0.91
157 0.91
158 0.89
159 0.88
160 0.86
161 0.87
162 0.85
163 0.85
164 0.82
165 0.8
166 0.79
167 0.78
168 0.78
169 0.73
170 0.72
171 0.7
172 0.69
173 0.68
174 0.67
175 0.62
176 0.58
177 0.61
178 0.61
179 0.59
180 0.63