Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BQ87

Protein Details
Accession A0A2V1BQ87    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
63-88QEREKEKKWDVLKRKWLKKRASWEVYHydrophilic
NLS Segment(s)
PositionSequence
69-82KKWDVLKRKWLKKR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MNPLTLNPPPEGNTTPRGYRLGGRRPTRPKAVTRDPTPATRDPLPVPATRDPNPKYRELFDTQEREKEKKWDVLKRKWLKKRASWEVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.33
5 0.3
6 0.33
7 0.38
8 0.42
9 0.47
10 0.5
11 0.56
12 0.62
13 0.67
14 0.69
15 0.65
16 0.63
17 0.62
18 0.68
19 0.67
20 0.62
21 0.63
22 0.57
23 0.56
24 0.54
25 0.47
26 0.41
27 0.35
28 0.33
29 0.27
30 0.29
31 0.28
32 0.24
33 0.26
34 0.27
35 0.3
36 0.31
37 0.38
38 0.35
39 0.41
40 0.43
41 0.43
42 0.41
43 0.39
44 0.42
45 0.38
46 0.41
47 0.4
48 0.44
49 0.42
50 0.46
51 0.47
52 0.45
53 0.43
54 0.45
55 0.43
56 0.44
57 0.5
58 0.54
59 0.6
60 0.66
61 0.75
62 0.78
63 0.84
64 0.86
65 0.87
66 0.86
67 0.85
68 0.86