Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NJD5

Protein Details
Accession A8NJD5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
120-144RGGGKRKRGSKGKYKGKGRERVRISBasic
153-174DYEVSPSKRQRVRRVSNAGESDHydrophilic
NLS Segment(s)
PositionSequence
120-141RGGGKRKRGSKGKYKGKGRERV
Subcellular Location(s) cyto 14.5, cyto_nucl 14, nucl 10.5
Family & Domain DBs
KEGG cci:CC1G_09700  -  
Amino Acid Sequences MSIVTNIPVPMIPVLDERLVCPTDGAKDHRSKIEIYNELLESLFHRELELSKLKESLLDMRTEIIEEAPTLDTNGAALAVSGPATELEAEGLSESAEESDGTGSGVVSSASDSEVKASVRGGGKRKRGSKGKYKGKGRERVRISGEELGALWDYEVSPSKRQRVRRVSNAGESDVEGEDAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.15
5 0.18
6 0.18
7 0.17
8 0.16
9 0.15
10 0.17
11 0.22
12 0.26
13 0.29
14 0.35
15 0.39
16 0.43
17 0.43
18 0.41
19 0.42
20 0.46
21 0.42
22 0.38
23 0.38
24 0.34
25 0.32
26 0.3
27 0.24
28 0.16
29 0.18
30 0.16
31 0.12
32 0.12
33 0.12
34 0.14
35 0.19
36 0.24
37 0.2
38 0.2
39 0.21
40 0.21
41 0.21
42 0.22
43 0.23
44 0.18
45 0.17
46 0.17
47 0.17
48 0.17
49 0.16
50 0.15
51 0.08
52 0.07
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.06
101 0.08
102 0.08
103 0.08
104 0.08
105 0.11
106 0.15
107 0.2
108 0.28
109 0.34
110 0.42
111 0.5
112 0.56
113 0.61
114 0.66
115 0.69
116 0.72
117 0.75
118 0.77
119 0.79
120 0.82
121 0.83
122 0.84
123 0.86
124 0.81
125 0.8
126 0.75
127 0.72
128 0.68
129 0.61
130 0.55
131 0.5
132 0.44
133 0.35
134 0.29
135 0.23
136 0.19
137 0.15
138 0.11
139 0.06
140 0.06
141 0.08
142 0.14
143 0.15
144 0.23
145 0.29
146 0.38
147 0.44
148 0.53
149 0.62
150 0.67
151 0.74
152 0.77
153 0.81
154 0.79
155 0.81
156 0.76
157 0.68
158 0.58
159 0.49
160 0.4
161 0.31