Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BIT4

Protein Details
Accession A0A2V1BIT4   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-135NAETSTRKWKREHRKRYKKQSHEGKASIBasic
150-182QTSMEQITPKKRFRKRYRKKKPKMNFIATKTEYHydrophilic
NLS Segment(s)
PositionSequence
114-127RKWKREHRKRYKKQ
158-172PKKRFRKRYRKKKPK
Subcellular Location(s) nucl 15.5, mito_nucl 11.666, cyto_nucl 10.833, mito 6.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDWTGLDCPVVLEFNLIPSSALLSSDLSSTTTNRTNQLCNERTRKPEGPDGRTDGRASIITTTSHHLSTCGLAEMTPDSTSTLRAQSHDEKATCGITEGERQSETLYNAETSTRKWKREHRKRYKKQSHEGKASITEGEKQSETTLQNEQTSMEQITPKKRFRKRYRKKKPKMNFIATKTEYYGSLHAHCHECKKQEPQPVMDGDILVQPSGAKRKLILRKGCLAFGTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.11
5 0.1
6 0.12
7 0.1
8 0.11
9 0.09
10 0.1
11 0.1
12 0.11
13 0.11
14 0.1
15 0.11
16 0.12
17 0.16
18 0.2
19 0.22
20 0.26
21 0.29
22 0.32
23 0.38
24 0.46
25 0.47
26 0.5
27 0.55
28 0.56
29 0.59
30 0.63
31 0.62
32 0.56
33 0.61
34 0.61
35 0.6
36 0.59
37 0.6
38 0.56
39 0.52
40 0.48
41 0.39
42 0.32
43 0.27
44 0.22
45 0.17
46 0.14
47 0.13
48 0.14
49 0.17
50 0.16
51 0.16
52 0.15
53 0.14
54 0.13
55 0.13
56 0.13
57 0.1
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.09
67 0.11
68 0.11
69 0.14
70 0.13
71 0.14
72 0.19
73 0.23
74 0.28
75 0.3
76 0.29
77 0.27
78 0.27
79 0.27
80 0.21
81 0.17
82 0.13
83 0.09
84 0.13
85 0.13
86 0.13
87 0.13
88 0.13
89 0.14
90 0.15
91 0.14
92 0.11
93 0.11
94 0.09
95 0.09
96 0.11
97 0.1
98 0.1
99 0.2
100 0.24
101 0.27
102 0.32
103 0.41
104 0.52
105 0.62
106 0.72
107 0.73
108 0.8
109 0.87
110 0.94
111 0.95
112 0.92
113 0.92
114 0.91
115 0.88
116 0.84
117 0.75
118 0.66
119 0.57
120 0.48
121 0.39
122 0.29
123 0.24
124 0.17
125 0.17
126 0.15
127 0.14
128 0.14
129 0.17
130 0.17
131 0.15
132 0.18
133 0.18
134 0.18
135 0.18
136 0.18
137 0.15
138 0.16
139 0.14
140 0.12
141 0.14
142 0.17
143 0.26
144 0.33
145 0.4
146 0.48
147 0.55
148 0.65
149 0.73
150 0.81
151 0.83
152 0.87
153 0.91
154 0.93
155 0.96
156 0.96
157 0.95
158 0.95
159 0.94
160 0.93
161 0.9
162 0.84
163 0.84
164 0.75
165 0.66
166 0.57
167 0.47
168 0.37
169 0.3
170 0.27
171 0.2
172 0.2
173 0.2
174 0.22
175 0.26
176 0.27
177 0.33
178 0.36
179 0.38
180 0.42
181 0.49
182 0.53
183 0.57
184 0.6
185 0.56
186 0.57
187 0.54
188 0.5
189 0.42
190 0.35
191 0.27
192 0.24
193 0.2
194 0.14
195 0.12
196 0.1
197 0.13
198 0.2
199 0.22
200 0.2
201 0.22
202 0.32
203 0.42
204 0.51
205 0.56
206 0.55
207 0.63
208 0.65
209 0.65