Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CV70

Protein Details
Accession A0A2V1CV70    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPANTGAKKQKKKDKAQHAVILDHydrophilic
NLS Segment(s)
PositionSequence
10-14KQKKK
Subcellular Location(s) nucl 12.5, mito_nucl 10, cyto 8, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKDKAQHAVILDKATSDKLYKDVQSYRLITVATLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLQIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.89
4 0.88
5 0.85
6 0.78
7 0.72
8 0.63
9 0.53
10 0.42
11 0.32
12 0.24
13 0.17
14 0.15
15 0.12
16 0.11
17 0.12
18 0.15
19 0.16
20 0.2
21 0.22
22 0.25
23 0.29
24 0.29
25 0.27
26 0.25
27 0.23
28 0.19
29 0.17
30 0.14
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.15
42 0.16
43 0.18
44 0.19
45 0.18
46 0.18
47 0.18
48 0.16
49 0.19
50 0.18
51 0.19
52 0.24
53 0.25
54 0.26
55 0.28
56 0.28
57 0.23
58 0.26
59 0.32
60 0.35
61 0.36
62 0.41
63 0.42
64 0.48
65 0.52
66 0.48
67 0.45
68 0.39
69 0.38
70 0.35