Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BN60

Protein Details
Accession A0A2V1BN60    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29ASTTHHCPKKSKGNCRYNKAKGYCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPKKGASTTHHCPKKSKGNCRYNKAKGYCTAHQTECTIHMLSTLLAKTVIRARELPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.69
4 0.7
5 0.73
6 0.8
7 0.84
8 0.86
9 0.82
10 0.81
11 0.74
12 0.67
13 0.63
14 0.6
15 0.55
16 0.5
17 0.46
18 0.39
19 0.36
20 0.34
21 0.28
22 0.23
23 0.22
24 0.18
25 0.14
26 0.13
27 0.12
28 0.11
29 0.13
30 0.11
31 0.09
32 0.09
33 0.1
34 0.12
35 0.17
36 0.19
37 0.19