Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1APP4

Protein Details
Accession A0A2V1APP4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-132EEKPSKKEPEPKKDSKKEADKFLEDISGKSKKDKKRKAEGQSGKPSKKSKKQKKTTBasic
NLS Segment(s)
PositionSequence
79-131KPSKKEPEPKKDSKKEADKFLEDISGKSKKDKKRKAEGQSGKPSKKSKKQKKT
Subcellular Location(s) nucl 19.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MAGLSQNVLNMKFMKGADNKGTEPAQPATYKKVKDSSEWFLPNRGQVQQKMKSAVKVNTVGYGSIASIAAEQEPEVEEKPSKKEPEPKKDSKKEADKFLEDISGKSKKDKKRKAEGQSGKPSKKSKKQKKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.29
4 0.33
5 0.36
6 0.35
7 0.36
8 0.37
9 0.31
10 0.32
11 0.28
12 0.26
13 0.24
14 0.25
15 0.29
16 0.34
17 0.34
18 0.34
19 0.39
20 0.37
21 0.4
22 0.44
23 0.43
24 0.45
25 0.48
26 0.45
27 0.42
28 0.41
29 0.39
30 0.35
31 0.33
32 0.29
33 0.3
34 0.37
35 0.39
36 0.41
37 0.44
38 0.43
39 0.43
40 0.44
41 0.41
42 0.37
43 0.33
44 0.31
45 0.27
46 0.26
47 0.22
48 0.17
49 0.14
50 0.1
51 0.07
52 0.07
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.04
61 0.05
62 0.06
63 0.07
64 0.09
65 0.1
66 0.15
67 0.2
68 0.23
69 0.27
70 0.36
71 0.45
72 0.54
73 0.62
74 0.67
75 0.73
76 0.78
77 0.81
78 0.81
79 0.82
80 0.76
81 0.77
82 0.72
83 0.64
84 0.57
85 0.5
86 0.47
87 0.36
88 0.32
89 0.29
90 0.29
91 0.27
92 0.33
93 0.4
94 0.45
95 0.55
96 0.64
97 0.68
98 0.74
99 0.83
100 0.85
101 0.88
102 0.89
103 0.88
104 0.89
105 0.89
106 0.84
107 0.81
108 0.81
109 0.8
110 0.81
111 0.82
112 0.82